Property Summary

NCBI Gene PubMed Count 91
PubMed Score 588.29
PubTator Score 199.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.208 7.4e-03
primary pancreatic ductal adenocarcinoma 1.044 1.9e-02
ductal carcinoma in situ -1.100 3.1e-03
ovarian cancer 1.500 2.2e-04

Protein-protein Interaction (5)

Gene RIF (80)

PMID Text
26708178 use GPX4 and GPX7 as possible markers for improving HCC diagnosis/prognosis.
26112936 GPX1, GPX3, and GPX4 genes may play a role in clear cell renal cell carcinoma cancerogenesis.
25884073 polymorphism of gene of glutathione peroxidase predisposes to more severe affection of liver and progression of chronic hepatitis C.
25851338 One SNP (rs3746162) in GPX4 was significantly associated with bladder cancer recurrence after transurethral resection.
25574043 GPx4 is essential for maintaining oxidative homeostasis and keeping defense against oxidative stress in conjunctival epithelial cells.
25516417 Hepatitis C virus (HCV) induces oxidative stress but controls it tightly by inducing ROS scavengers. Among these, GPx4 plays an essential role in the HCV life cycle.
24706940 Identification of truncating mutations in GPX4 in two families affected with Sedaghatian-type spondylometaphyseal dysplasia.
24191733 A membrane glycoprotein GPX4 was shown to play a significant role in gamete interactions.
24039907 Erythrocyte glutathione peroxidase activity is modified by single nucleotide polymorphisms in SEPP1, GPX4 and GPX1 and by estrogens.
23934705 GPX4c718t SNP is functional and that variants of this SNP can have detrimental consequences on endothelial function leading to a greater risk of vascular disease.
23919599 neither CYBB nor GPX4 are major genetic determinants of diabetic nephropathy, but nevertheless, they could modulate in a gender-specific manner the risk for renal disease in patients with type 1 diabetes.
23721877 Methamphetamine increases oxidative stress by reducing GPx1/4 levels, and this can be reversed with addition of selenium.
22634395 GPx4, through effects on AIF, plays a major role in maintaining the oxidative phosphorylation system and protecting mitochondria from oxidative damage.
22158110 It was shown for the first time that the C718T polymorphism in the 3'-untranslated region of the GPX4 gene could be considered as a genetic marker of susceptibility to cerebral stroke in patients with essential hypertension.
21733339 genetic association studies in a Han Chinese population in Shaanxi province: Data indicate that 2 SNP in GPx4 (rs713041, rs4807542) and down-regulation of expression of GPx4 mRNA may be related to development of Kashin-Beck disease.
21644221 The SNPs of 5'-UTR region of the GPx4 gene might not be associated with oligo- or asthenozoospermic male infertility
21459128 the T/C variant GPX4 (rs713041) alters the pattern of selenoprotein synthesis if selenium intake is low
21252226 a direct role of nuclear GPx4 in the (selenium-dependent) prevention of oxidative damage in the gastrointestinal tract.
21052528 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20852007 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20813000 Meta-analysis of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20477822 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378690 Observational study of gene-disease association. (HuGE Navigator)
20303587 We have shown highly significant reductions in expression of all three major classes of GPx in placentae from women with preeclampsia.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19744930 Short form Gpx4 protein is present in mitochondria and is essential for survival and protection against apoptosis, whereas the long form Gpx4 protein is important for male fertility.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19524426 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of glutathione peroxidase 4 (GPX4) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19285650 preeclampsia is associated with a specific antioxidant response in both maternal and fetal circulations, likely in response to the deleterious oxidative stress observed in this syndrome
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19161995 Observational study of genetic testing. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18483336 No significant risk for GPX4 in colorectal adenoma.
18483336 Observational study of gene-disease association. (HuGE Navigator)
18400727 The GPX4c718t SNP both alters protein binding to the 3'UTR in vitro and influences the concentration of lymphocyte GPx4 and other selenoproteins in vivo
18400727 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17634480 Observational study of gene-disease association. (HuGE Navigator)
17634480 These data provide strong support for the hypothesis that common variation in GPX4 is associated with prognosis after a diagnosis of breast cancer.
17630701 Results show the he crystal structure of the catalytically active U46C mutant of GPx4 and site-directed mutagenesis revealed amino acid residues important for catalysis and covalent protein polymerization.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17516241 Phospholipid hydroperoxide glutathione peroxidase expression is downregulated in poorly differentiated breast invasive ductal carcinoma
17052796 Role for selenium in risk of lung cancer and independent regulation of GPX4 in a tumor cell line.
17020817 we investigated both GPx-4 activity and localization in subcellular fractions of human platelets. Confocal immunofluorescence microscopy localized mainly GPx-4 to membranes of activated platelets in contrast to cytoplasm in the resting cells.
16979635 We have been able to correlate embryo morphology on day 3 with the sperm expression of GPX family members.
16872467 Oligoasthenozoospermia is associated with a decrease in the level of expression of PHGPx in the spermatozoa of some infertile men but is not linked to mutations in PHGPx gene.
16868544 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16424062 Observational study of gene-disease association. (HuGE Navigator)
15978628 Increased activities of erythrocyte glutathione peroxidase is associated with cerebral palsy
15910762 HIV-1 Tat causes a greater than 50% decrease in intracellular reduced glutathione (GSH), leading to the extracellular appearance of acidic FGF-1, an effect that is partially mediated through modulation of GSH biosynthetic enzymes
15474074 Intracellular sperm GSH system components GPX-4 and GSH are altered in infertile men, and these alterations seem to be linked to sperm morphology.
15308634 PHGPx modulates the induction of MMP-1 and collagenase.
15256721 This review addresses the role of mitochondrial phospholipid hydroperoxide glutathione peroxidase in the regulation of apoptosis.
15225122 Sperm nucleus PHGPx expression is mediated by the transcription factor CREM-tau, which acts as a cis-acting element localized in the first intron of the PHGPx gene.
15149466 No statistically significant differences for glutathione peroxidase, phospholipid hydroperoxide glutathione peroxidase, and glutathione reductase were encountered between normal values and those of asthenozoospermic patients.
14642406 lipids, cytokines and antioxidants modulate GPx4 in a complex manner that in the presence of adequate selenium, may favour protection against potentially proatherogenic processes.
12958179 GPX4 up-regulates arachidonate metabolism in a epidermoid carcinoma tumor cell line.
12868489 PhGPx can lower the peroxide tone, which might change the cellular redox environment resulting in a delay in G1 transit
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12606444 Observational study of gene-disease association. (HuGE Navigator)
12606444 Gpx-4 polymorphism cannot generally account for the correlation of phospholipid hydroperoxide glutathione peroxidase content of sperm and fertility-related parameters. Further examination of this gene as a potential cause of infertility is warranted.
12490284 data from screening of the region of the GPX4 gene corresponding to the 3'UTR show a T/C variant at position 718 that affects the levels of lymphocyte 5-lipoxygenase total products
12427732 tissue distribution of alternatively spliced snGPx
12193409 sperm content of phospholipid hydroperoxide glutathione peroxidase is correlated with fertility-related parameters and can be considered a predictive measure for fertilization capacity in humans
12152199 an examination of gene expression
11898409 Glutathione peroxidase is a moonlighting protein that functions both as a peroxidase as well as a structural protein in mature spermatozoa.
11368344 HIV-1 Tat causes a greater than 50% decrease in intracellular reduced glutathione (GSH), leading to the extracellular appearance of acidic FGF-1, an effect that is partially mediated through modulation of GSH biosynthetic enzymes
10652368 HIV-1 Tat causes a greater than 50% decrease in intracellular reduced glutathione (GSH), leading to the extracellular appearance of acidic FGF-1, an effect that is partially mediated through modulation of GSH biosynthetic enzymes
9501919 HIV-1 Tat causes a greater than 50% decrease in intracellular reduced glutathione (GSH), leading to the extracellular appearance of acidic FGF-1, an effect that is partially mediated through modulation of GSH biosynthetic enzymes

AA Sequence

MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVA      1 - 70
SQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDA     71 - 140
HPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF                 141 - 197
//

Text Mined References (94)

PMID Year Title
26708178 2015 GPX4 and GPX7 over-expression in human hepatocellular carcinoma tissues.
26112936 2015 Aberrant expression of selenium-containing glutathione peroxidases in clear cell renal cell carcinomas.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25884073 2014 [The relationship between content of malonic aldehyde, activity of glutathione peroxidase and polymorphism of gene GPX4 (718C/T) under chronic hepatitis C].
25851338 2015 Genetic Variations in Glutathione Pathway Genes Predict Cancer Recurrence in Patients Treated with Transurethral Resection and Bacillus Calmette-Guerin Instillation for Non-muscle Invasive Bladder Cancer.
25574043 2015 Role of glutathione peroxidase 4 in conjunctival epithelial cells.
25516417 2016 Glutathione peroxidase 4 is reversibly induced by HCV to control lipid peroxidation and to increase virion infectivity.
24706940 2014 Mutations in the enzyme glutathione peroxidase 4 cause Sedaghatian-type spondylometaphyseal dysplasia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24191733 2013 Mapping of the N-linked glycoproteome of human spermatozoa.
24170573 2013 Expression and characterization of recombinant human phospholipid hydroperoxide glutathione peroxidase.
24039907 2013 Association between polymorphisms in glutathione peroxidase and selenoprotein P genes, glutathione peroxidase activity, HRT use and breast cancer risk.
23934705 2013 The single-nucleotide polymorphism (GPX4c718t) in the glutathione peroxidase 4 gene influences endothelial cell function: interaction with selenium and fatty acids.
23919599 2013 Sex-specific associations of variants in regulatory regions of NADPH oxidase-2 (CYBB) and glutathione peroxidase 4 (GPX4) genes with kidney disease in type 1 diabetes.
23721877 2013 Methamphetamine decreases levels of glutathione peroxidases 1 and 4 in SH-SY5Y neuronal cells: protective effects of selenium.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23201771 2013 Glutathione peroxidases.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22634395 2012 Glutathione peroxidase 4 has a major role in protecting mitochondria from oxidative damage and maintaining oxidative phosphorylation complexes in gut epithelial cells.
22158110 2012 The C718T polymorphism in the 3'-untranslated region of glutathione peroxidase-4 gene is a predictor of cerebral stroke in patients with essential hypertension.
21733339 2012 SNP and mRNA expression for glutathione peroxidase 4 in Kashin-Beck disease.
21644221 2011 [Association between single nucleotide polymorphisms of 5'-untranslated region of GPx4 gene and male infertility].
21630459 2011 Proteomic characterization of the human sperm nucleus.
21459128 2011 A T/C polymorphism in the GPX4 3'UTR affects the selenoprotein expression pattern and cell viability in transfected Caco-2 cells.
21269460 2011 Initial characterization of the human central proteome.
21252226 2011 Induction of glutathione peroxidase 4 expression during enterocytic cell differentiation.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21052528 2010 Polymorphisms in the selenoprotein S and 15-kDa selenoprotein genes are associated with altered susceptibility to colorectal cancer.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20852007 2010 Effects of selenium status and polymorphisms in selenoprotein genes on prostate cancer risk in a prospective study of European men.
20813000 2010 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma in a pooled analysis of three studies.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20477822 2011 Single-nucleotide polymorphisms within the antioxidant defence system and associations with aggressive prostate cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378690 2010 Genetic variants in selenoprotein genes increase risk of colorectal cancer.
20303587 2010 Differential expression and distribution of placental glutathione peroxidases 1, 3 and 4 in normal and preeclamptic pregnancy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19744930 2009 Short form glutathione peroxidase 4 is the essential isoform required for survival and somatic mitochondrial functions.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19524426 2009 Leukotriene pathway polymorphisms are associated with altered cysteinyl leukotriene production in children with acute asthma.
19285650 2009 Specific systemic antioxidant response to preeclampsia in late pregnancy: the study of intracellular glutathione peroxidases in maternal and fetal blood.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19161995 2009 Simultaneous genotyping of 11 non-synonymous SNPs in the 4 glutathione peroxidase genes using the multiplex single base extension method.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18483336 2008 Variation in the selenoenzyme genes and risk of advanced distal colorectal adenoma.
18400727 2008 Functional effects of a common single-nucleotide polymorphism (GPX4c718t) in the glutathione peroxidase 4 gene: interaction with sex.
17634480 2007 Common germline genetic variation in antioxidant defense genes and survival after diagnosis of breast cancer.
17630701 2007 Structural basis for catalytic activity and enzyme polymerization of phospholipid hydroperoxide glutathione peroxidase-4 (GPx4).
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17516241 2007 Phospholipid hydroperoxide glutathione peroxidase (PHGPx) expression is downregulated in poorly differentiated breast invasive ductal carcinoma.
17052796 2007 Effects of selenium supplementation on expression of glutathione peroxidase isoforms in cultured human lung adenocarcinoma cell lines.
17020817 2006 Phospholipid-hydroperoxide glutathione peroxidase (GPx-4) localization in resting platelets, and compartmental change during platelet activation.
16979635 2006 Effect of sperm glutathione peroxidases 1 and 4 on embryo asymmetry and blastocyst quality in oocyte donation cycles.
16872467 2006 Failure of phospholipid hydroperoxide glutathione peroxidase expression in oligoasthenozoospermia and mutations in the PHGPx gene.
16868544 2006 Interactions between genes involved in the antioxidant defence system and breast cancer risk.
16424062 2006 Tagging single-nucleotide polymorphisms in antioxidant defense enzymes and susceptibility to breast cancer.
16341674 2005 Transcriptome analysis of human gastric cancer.
15978628 2005 Antioxidant enzymes and lipid peroxides in children with cerebral palsy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474074 2004 Relationship among standard semen parameters, glutathione peroxidase/glutathione reductase activity, and mRNA expression and reduced glutathione content in ejaculated spermatozoa from fertile and infertile men.
15308634 2004 Overexpression of phospholipid-hydroperoxide glutathione peroxidase in human dermal fibroblasts abrogates UVA irradiation-induced expression of interstitial collagenase/matrix metalloproteinase-1 by suppression of phosphatidylcholine hydroperoxide-mediated NFkappaB activation and interleukin-6 release.
15256721 2004 Role of mitochondrial phospholipid hydroperoxide glutathione peroxidase (PHGPx) as an antiapoptotic factor.
15225122 2004 cAMP-response element modulator-tau activates a distinct promoter element for the expression of the phospholipid hydroperoxide/sperm nucleus glutathione peroxidase gene.
15149466 2004 Native specific activity of glutathione peroxidase (GPx-1), phospholipid hydroperoxide glutathione peroxidase (PHGPx) and glutathione reductase (GR) does not differ between normo- and hypomotile human sperm samples.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14642406 2003 Regulation of selenoprotein GPx4 expression and activity in human endothelial cells by fatty acids, cytokines and antioxidants.
12958179 2003 Depletion of phospholipid hydroperoxide glutathione peroxidase up-regulates arachidonate metabolism by 12S-lipoxygenase and cyclooxygenase 1 in human epidermoid carcinoma A431 cells.
12868489 2003 Phospholipid hydroperoxide glutathione peroxidase induces a delay in G1 of the cell cycle.
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12606444 2003 Genetic variations of gpx-4 and male infertility in humans.
12490284 A novel single nucleotide polymorphism in the 3' untranslated region of human glutathione peroxidase 4 influences lipoxygenase metabolism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427732 2003 Regulation of expression of the phospholipid hydroperoxide/sperm nucleus glutathione peroxidase gene. Tissue-specific expression pattern and identification of functional cis- and trans-regulatory elements.
12193409 2002 Male fertility is linked to the selenoprotein phospholipid hydroperoxide glutathione peroxidase.
12152199 2002 Expression of human phospholipid hydroperoxide glutathione peroxidase.
11898409 2002 Phospholipid-hydroperoxide glutathione peroxidase in sperm.
11368344 2001 Human immunodeficiency virus type 1 Tat protein impairs selenoglutathione peroxidase expression and activity by a mechanism independent of cellular selenium uptake: consequences on cellular resistance to UV-A radiation.
10652368 2000 Molecular mechanism of decreased glutathione content in human immunodeficiency virus type 1 Tat-transgenic mice.
10464096 1999 Dual function of the selenoprotein PHGPx during sperm maturation.
9705830 1998 Structural organization of the human selenium-dependent phospholipid hydroperoxide glutathione peroxidase gene (GPX4): chromosomal localization to 19p13.3.
9501919 1998 Glutathione depletion associated with the HIV-1 TAT protein mediates the extracellular appearance of acidic fibroblast growth factor.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8287691 1994 The human glutathione peroxidase genes GPX2, GPX3, and GPX4 map to chromosomes 14, 5, and 19, respectively.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8039723 1994 Cloning and sequencing of the cDNA encoding a human testis phospholipid hydroperoxide glutathione peroxidase.