Property Summary

NCBI Gene PubMed Count 49
PubMed Score 197.61
PubTator Score 83.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (40)

AA Sequence

MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQ      1 - 70
FGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLI     71 - 140
IWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI                        141 - 190
//

Text Mined References (51)

PMID Year Title