Property Summary

NCBI Gene PubMed Count 12
PubMed Score 175.93
PubTator Score 64.69

Knowledge Summary


No data available


  Differential Expression (12)

Disease log2 FC p
chronic lymphosyte leukemia 1.400 1.3e-07
acute quadriplegic myopathy -1.631 6.6e-06
non-small cell lung cancer 2.306 4.9e-20
intraductal papillary-mucinous adenoma (... -1.500 1.8e-02
intraductal papillary-mucinous carcinoma... -1.200 3.8e-02
group 3 medulloblastoma -1.300 1.3e-02
psoriasis 1.400 2.6e-27
lung adenocarcinoma 2.000 1.0e-09
Polycystic Ovary Syndrome -1.489 2.8e-03
lung carcinoma 1.500 4.7e-15
Breast cancer 1.100 4.8e-04
ovarian cancer 1.800 3.9e-07

Gene RIF (8)

25758935 Recessively inherited loss of function GPT2 mutations are a novel cause of intellectual disability.
24418603 ATF4 silencing prevented the activating effect of histidinol and tunicamycin on ATF4 and ALT2 expression. Our findings point to ALT2 as an enzyme involved in the metabolic adaptation of the cell to stress
20877624 Observational study of gene-disease association. (HuGE Navigator)
19360321 A clinical method for selective measurement of ALT1 and 2 in human plasma is described.
18854154 Knockdown of glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17596883 Elevation of liver enzymes and hepatic insulin resistance as reflected by fasting insulin occur in the early stages of insulin resistance and highlight the central role of the liver in insulin resistance in the general population.
17109502 The biliary IL-6 and TNF-alpha levels were positively correlated with serum DBIL, TBA and gamma-GT levels in infantile hepatitis syndrome subjects.
11863375 expression of GPT2 especially in muscle and fat, suggests a unique and previously unrecognized role of this gene product in glucose, amino acid, and fatty acid metabolism and homeostasis.

AA Sequence

YHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA                                         491 - 523

Text Mined References (13)

PMID Year Title
25758935 2015 Loss of function mutation in glutamic pyruvate transaminase 2 (GPT2) causes developmental encephalopathy.
24418603 2014 Activating transcription factor 4 mediates up-regulation of alanine aminotransferase 2 gene expression under metabolic stress.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19360321 2009 Detection of the mitochondrial and catalytically active alanine aminotransferase in human tissues and plasma.
17596883 2007 A comparison of associations of alanine aminotransferase and gamma-glutamyltransferase with fasting glucose, fasting insulin, and glycated hemoglobin in women with and without diabetes.
17109502 2006 Alterations of biliary biochemical constituents and cytokines in infantile hepatitis syndrome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11863375 2002 cDNA cloning, genomic structure, chromosomal mapping, and functional expression of a novel human alanine aminotransferase.