Property Summary

NCBI Gene PubMed Count 21
PubMed Score 89.98
PubTator Score 20.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis -1.200 2.4e-02
malignant mesothelioma 2.500 1.2e-08
cutaneous lupus erythematosus 1.500 7.2e-03
osteosarcoma -1.366 5.7e-03
non-small cell lung cancer -1.124 5.7e-13
interstitial cystitis 1.200 3.9e-03
group 3 medulloblastoma -1.200 1.0e-03
ulcerative colitis 1.100 1.8e-03
ovarian cancer -1.200 1.8e-06

Synonym

Accession Q9Y4H4 A2BFJ3
Symbols G18
NG1
AGS4
G18.2
C6orf9
G18.1a
G18.1b

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

PMID Text
25271165 findings suggest that GPSM3 acts as a direct negative regulator of NLRP3 function.
22843681 Phosphorylation of GPSM3 by a proline-directed serine/threonine kinase and the resultant association of 14-3-3 is the first description of post-translational regulation of GPSM3 subcellular localization
22167191 GPSM3 increases Gbeta stability until formation of the Gbetagamma dimer, including association of the Gbeta-GPSM3 complex with phosducin-like protein PhLP and T-complex protein 1 subunit eta (CCT7), two known chaperones of neosynthesized Gbeta subunits.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20452976 AGS4-Galpha(i) complexes directly couple to a G-protein-coupled receptor and may serve as substrates for agonist-induced G-protein activation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19659809 Observational study of gene-disease association. (HuGE Navigator)
14656218 Mutational analysis of the role of GoLoco motifs in guanine nucleotide dissociation inhibitor activity of G18 protein.

AA Sequence

MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVA      1 - 70
EAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLL     71 - 140
RVQGGGRMEEQRSRPPTHTC                                                      141 - 160
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25271165 2014 G Protein signaling modulator-3 inhibits the inflammasome activity of NLRP3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
22843681 2012 Regulation of the subcellular localization of the G-protein subunit regulator GPSM3 through direct association with 14-3-3 protein.
22167191 2012 G-protein signaling modulator-3 regulates heterotrimeric G-protein dynamics through dual association with G? and G?i protein subunits.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20452976 2010 Receptor-regulated interaction of activator of G-protein signaling-4 and Galphai.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19659809 2009 Confirmation of the novel association at the BTNL2 locus with ulcerative colitis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15096500 2004 Identification and characterization of AGS4: a protein containing three G-protein regulatory motifs that regulate the activation state of Gialpha.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14656218 2004 Guanine nucleotide dissociation inhibitor activity of the triple GoLoco motif protein G18: alanine-to-aspartate mutation restores function to an inactive second GoLoco motif.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2259622 1990 Human major histocompatibility complex contains a new cluster of genes between the HLA-D and complement C4 loci.