Property Summary

NCBI Gene PubMed Count 37
PubMed Score 772.67
PubTator Score 76.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Gene RIF (22)

PMID Text
26751642 This study determined the crystallographic structure of human Afadin in complex with LGN.
26662512 Kinocilium is essential for proper localization of Lgn, as well as Gai and aPKC, suggesting that cilium function plays a role in positioning of apical proteins critical for hearing.
26398908 results fit a model whereby LGN influences interphase microtubule dynamics in endothelial cells to regulate migration, cell adhesion, and sprout extension, and reveal a novel non-mitotic role for LGN in sprouting angiogenesis
25664792 A crystal structure of Frmpd4-bound LGN in an oxidized form is also reported, although oxidation does not appear to strongly affect the interaction with Frmpd4.
24165937 Hepatocyte Par1b defines lumen position in concert with the position of the astral microtubule anchoring complex LGN-NuMA to yield the distinct epithelial division phenotypes.
23907121 LGN is required for mitotic spindle rotation but not orientation maintenance.
23494849 one homozygous frameshift GPSM2 variants c.1473delG was identified in three Chudley-McCullough syndrome Dutch patients.
23389635 Data indicate that dynein- and astral microtubule-mediated transport of Galphai/LGN/nuclear mitotic apparatus (NuMA) complex from cell cortex to spindle poles.
22987632 Results show compound heterozygous mutations in the GPSM2 gene, in affected members of a family with Chudley-McCullough syndrome, co-segregate in the family as an autosomal recessive trait.
22977735 Studies indicate that the Inscuteable (Insc)and NuMA are mutually exclusive interactors of LGN.
22690686 Overexpression of LGN decreases the activity of cellular sGC, whereas knockdown of LGN mRNA and protein correlated with increased sGC activity
22578326 GPSM2 is required for orienting the mitotic spindle during cell division in multiple tissues, suggesting that the sensorineural hearing loss and characteristic brain malformations of CMS are due to defects in asymmetric cell divisions during development
22074847 mInsc-LGN interaction is vital for stabilization of LGN and for intracellular localization of mInsc.
21348867 A novel truncating mutation of GPSM2 is associated with autosomal recessive non-syndromic hearing loss.
20933426 During mitosis, Pins is mislocalized to the apical surface in the absence of Par3 or by inhibition of atypical protein kinase C.
20602914 Identification of GPSM2 as essential to the development of normal hearing suggests dysregulation of cell polarity as a mechanism underlying hearing loss.
20589935 Upregulation of GPSM2 is associated with breast cancer.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20479129 Ric-8A and Gi alpha recruit LGN, NuMA, and dynein to the cell cortex to help orient the mitotic spindle.
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15632202 binding between Lgl2 and LGN play a role in mitotic spindle organization through regulating formation of the LGN.NuMA complex; Lgl2 forms a Lgl2.Par-6.aPKC.LGN complex, which responds to mitotic signaling to establish normal cell division
11832491 LGN is expressed in neuronal, astroglial, and microglial cultures

AA Sequence

MEENLISMREDHSFHVRYRMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGN      1 - 70
AYFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVG     71 - 140
EARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQAAVDFYEENLSLVTALGDRAAQGRAFGNLGN    141 - 210
THYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAV    211 - 280
EAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLE    281 - 350
ISREVGDKSGELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELMKLTPE    351 - 420
KVQNWNSEILAKQKPLIAKPSAKLLFVNRLKGKKYKTNSSTKVLQDASNSIDHRIPNSQRKISADTIGDE    421 - 490
GFFDLLSRFQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLD    491 - 560
DQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFDILVKCQGSRLDDQRCAPPPATTKGPTVPDED    561 - 630
FFSLILRSQGKRMDEQRVLLQRDQNRDTDFGLKDFLQNNALLEFKNSGKKSADH                    631 - 684
//

Text Mined References (40)

PMID Year Title
27180139 2016 A novel nonsense GPSM2 mutation in a Yemeni family underlying Chudley-McCullough syndrome.
26751642 2016 Concomitant binding of Afadin to LGN and F-actin directs planar spindle orientation.
26662512 2016 The GPSM2/LGN GoLoco motifs are essential for hearing.
26398908 2015 LGN Directs Interphase Endothelial Cell Behavior via the Microtubule Network.
25664792 2015 Structural basis for the recognition of the scaffold protein Frmpd4/Preso1 by the TPR domain of the adaptor protein LGN.
24165937 2013 Par1b links lumen polarity with LGN-NuMA positioning for distinct epithelial cell division phenotypes.
23907121 2013 Automated tracking of mitotic spindle pole positions shows that LGN is required for spindle rotation but not orientation maintenance.
23783028 2013 RanGTP and CLASP1 cooperate to position the mitotic spindle.
23494849 2013 GPSM2 and Chudley-McCullough syndrome: a Dutch founder variant brought to North America.
23389635 2013 Evidence for dynein and astral microtubule-mediated cortical release and transport of G?i/LGN/NuMA complex in mitotic cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22987632 2012 GPSM2 mutations in Chudley-McCullough syndrome.
22977735 2012 On the inscrutable role of Inscuteable: structural basis and functional implications for the competitive binding of NuMA and Inscuteable to LGN.
22690686 2012 The G-protein regulator LGN modulates the activity of the NO receptor soluble guanylate cyclase.
22578326 2012 GPSM2 mutations cause the brain malformations and hearing loss in Chudley-McCullough syndrome.
22074847 2011 Structural basis for interaction between the conserved cell polarity proteins Inscuteable and Leu-Gly-Asn repeat-enriched protein (LGN).
21897333 2011 Genes linked to energy metabolism and immunoregulatory mechanisms are associated with subcutaneous adipose tissue distribution in HIV-infected men.
21816348 2011 LGN/mInsc and LGN/NuMA complex structures suggest distinct functions in asymmetric cell division for the Par3/mInsc/LGN and G?i/LGN/NuMA pathways.
21348867 2012 A truncating mutation in GPSM2 is associated with recessive non-syndromic hearing loss.
20933426 2010 Par3 controls epithelial spindle orientation by aPKC-mediated phosphorylation of apical Pins.
20602914 2010 Whole exome sequencing and homozygosity mapping identify mutation in the cell polarity protein GPSM2 as the cause of nonsyndromic hearing loss DFNB82.
20589935 2010 Critical roles of LGN/GPSM2 phosphorylation by PBK/TOPK in cell division of breast cancer cells.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20479129 2010 Ric-8A and Gi alpha recruit LGN, NuMA, and dynein to the cell cortex to help orient the mitotic spindle.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
19888295 2010 Five novel loci for inherited hearing loss mapped by SNP-based homozygosity profiles in Palestinian families.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16458856 2006 Two forms of human Inscuteable-related protein that links Par3 to the Pins homologues LGN and AGS3.
15632202 2005 Direct binding of Lgl2 to LGN during mitosis and its requirement for normal cell division.
15537540 2004 Mammalian Pins is a conformational switch that links NuMA to heterotrimeric G proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12925752 2003 Subcellular localization of LGN during mitosis: evidence for its cortical localization in mitotic cell culture systems and its requirement for normal cell cycle progression.
12748287 2003 Identification of tetratricopeptide repeat 1 as an adaptor protein that interacts with heterotrimeric G proteins and the small GTPase Ras.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11832491 2002 Expression analysis and subcellular distribution of the two G-protein regulators AGS3 and LGN indicate distinct functionality. Localization of LGN to the midbody during cytokinesis.
11781568 2001 A mammalian Partner of inscuteable binds NuMA and regulates mitotic spindle organization.
8973305 1996 Identification and cDNA cloning of a novel human mosaic protein, LGN, based on interaction with G alpha i2.