Property Summary

NCBI Gene PubMed Count 32
PubMed Score 28.55
PubTator Score 36.16

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (16)

PMID Text
25812748 Activator of G-protein Signaling 3 is an important regulator of esophageal squamous cell carcinoma proliferation
25740824 High GPSM1 gene methylation is associated with gastric tumor aggressiveness.
25480567 Results confirmed that Ric-8A can directly bind to AGS3S but failed to facilitate Galpha(i)-induced suppression of adenylyl cyclase, suggesting that it may not serve as a guanine exchange factor for AGS3/Galpha(i/o)-GDP complex in a cellular environment.
24510965 these results indicate that GRK6 complexes with AGS3-Galphai2 to regulate CXCR2-mediated leukocyte functions at different levels, including downstream effector activation, receptor trafficking, and expression at the cell membrane.
24307516 Our data indicate that decreased expression of AGS3 is correlated with reduced levels of p-CREB in the apoptotic model. The negative role of AGS3 in cell apoptosis was further confirmed by knocking down AGS3.
23945395 Data identified three new loci for type 2 diabetes with genome-wide significance: MIR129-LEP, GPSM1 and SLC16A13.
21209316 These results provide mechanistic insights into how reversible modulation of Galpha(i3) activity by AGS3 and GIV maintains the delicate equilibrium between promotion and inhibition of autophagy.
20716524 AGS3 receptor coupling to both Galphabetagamma and GPR-Galpha(i) offer additional flexibility for systems to respond and adapt to challenges and orchestrate complex behaviors
20237496 Observational study of gene-disease association. (HuGE Navigator)
20126274 unlike wild-type AGS3, over-expression of an AGS3 mutant lacking this modification fails to enhance macroautophagic activity. These observations imply that AGS3 phosphorylation may participate in the modulation of macroautophagy
20065032 These data present AGS3, G-proteins, and mInsc as candidate proteins involved in regulating cellular stress associated with protein-processing pathologies.
18566450 The PDZ and band 4.1 containing protein Frmpd1 regulates the subcellular location of activator of G-protein signaling 3 and its interaction with G-proteins.
17991770 data support a model wherein AGS3 modulates the protein trafficking along the TGN/plasma membrane/endosome loop
12925752 cortical localization in mitotic cell culture systems and requirement for normal cell cycle progression
12642577 AGS3 is involved in an early event during the autophagic pathway probably prior to the formation of the autophagosome.
10969064 The GPR motif in this protein and other proteins is actually associated with activity as a GDI - guanine nucleotide dissociation inhibitor and not GTPase activator as initially suggested.

AA Sequence

MAGPAPPVADELPGPAARRLYSRMEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTEDLKTLSAIYS      1 - 70
QLGNAYFYLKEHGRALEYHKHDLLLARTIGDRMGEAKASGNLGNTLKVLGRFDEAAVCCQRHLSIAQEQG     71 - 140
DKVGEARALYNIGNVYHAKGKQLSWNAANATQDPGHLPPDVRETLCKASEFYERNLSLVKELGDRAAQGR    141 - 210
AYGNLGNTHYLLGNFTEATTFHKERLAIAKEFGDKAAERRAYSNLGNAHVFLGRFDVAAEYYKKTLQLSR    211 - 280
QLRDQAVEAQACYSLGNTYTLLQDYERAAEYHLRHLLIAQELADRVGEGRACWSLGNAYVSMGRPAQALT    281 - 350
FAKKHLQISQEIGDRHGELTARMNVAQLQLVLGRLTSPAASEKPDLAGYEAQGARPKRTQRLSAETWDLL    351 - 420
RLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRA    421 - 490
PSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQS    491 - 560
RRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQSSRIDDQRCPPPDVLPRGPTMPD    561 - 630
EDFFSLIQRVQAKRMDEQRVDLAGGPEQGAGGPPEPQQQCQPGAS                             631 - 675
//

Text Mined References (40)

PMID Year Title
25812748 2015 Overexpression of activator of G-protein signaling 3 decreases the proliferation of esophageal squamous cell carcinoma.
25740824 2015 Epigenetic clustering of gastric carcinomas based on DNA methylation profiles at the precancerous stage: its correlation with tumor aggressiveness and patient outcome.
25480567 2015 Activator of G protein signaling 3 forms a complex with resistance to inhibitors of cholinesterase-8A without promoting nucleotide exchange on G?(i3).
25416956 2014 A proteome-scale map of the human interactome network.
24510965 2014 G Protein-coupled receptor kinase-6 interacts with activator of G protein signaling-3 to regulate CXCR2-mediated cellular functions.
24307516 2014 A role for activator of G-protein signaling 3 (AGS3) in multiple myeloma.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21209316 2011 A GDI (AGS3) and a GEF (GIV) regulate autophagy by balancing G protein activity and growth factor signals.
20716524 2010 Regulation of the AGS3·G{alpha}i signaling complex by a seven-transmembrane span receptor.
20700046 2010 Activators of G-protein signaling 3: a drug addiction molecular gateway.
20488951 2010 Activator of G protein signaling 3 promotes epithelial cell proliferation in PKD.
20305814 2010 Identification of a deubiquitinating enzyme as a novel AGS3-interacting protein.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20126274 2010 An inhibitory role of the G-protein regulator AGS3 in mTOR-dependent macroautophagy.
20065032 2010 Distribution of activator of G-protein signaling 3 within the aggresomal pathway: role of specific residues in the tetratricopeptide repeat domain and differential regulation by the AGS3 binding partners Gi(alpha) and mammalian inscuteable.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18566450 2008 The PDZ and band 4.1 containing protein Frmpd1 regulates the subcellular location of activator of G-protein signaling 3 and its interaction with G-proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17991770 2007 A specific role of AGS3 in the surface expression of plasma membrane proteins.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16458856 2006 Two forms of human Inscuteable-related protein that links Par3 to the Pins homologues LGN and AGS3.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15537540 2004 Mammalian Pins is a conformational switch that links NuMA to heterotrimeric G proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14994339 2004 Asymmetric localization of LGN but not AGS3, two homologs of Drosophila pins, in dividing human neural progenitor cells.
14684460 2003 AGS3: a G-Protein regulator of addiction-associated behaviors.
14530282 2003 Thermodynamic characterization of the binding of activator of G protein signaling 3 (AGS3) and peptides derived from AGS3 with G alpha i1.
12925752 2003 Subcellular localization of LGN during mitosis: evidence for its cortical localization in mitotic cell culture systems and its requirement for normal cell cycle progression.
12642577 2003 The G-protein regulator AGS3 controls an early event during macroautophagy in human intestinal HT-29 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11832491 2002 Expression analysis and subcellular distribution of the two G-protein regulators AGS3 and LGN indicate distinct functionality. Localization of LGN to the midbody during cytokinesis.
11278352 2001 Identification of a truncated form of the G-protein regulator AGS3 in heart that lacks the tetratricopeptide repeat domains.
11024022 2000 AGS3 inhibits GDP dissociation from galpha subunits of the Gi family and rhodopsin-dependent activation of transducin.
10969064 2000 Stabilization of the GDP-bound conformation of Gialpha by a peptide derived from the G-protein regulatory motif of AGS3.