Property Summary

NCBI Gene PubMed Count 32
PubMed Score 9.57
PubTator Score 38.38

Knowledge Summary

Patent

No data available

Synonym

Accession Q13227 B4DXA1 Q6FHM8 GPS-2
Symbols AMF-1

Gene

PDB

2L5G  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (14)

PMID Text
26070566 regulation of GPS2 by posttranslational modifications provides an effective strategy for modulating its molecular function within the nuclear compartment.
25139254 Chromosomal translocation in a pediatric undifferentiated spindle cell sarcoma have characterized this alteration to show rearrangement of the MLL4 and GPS2 genes, resulting in fusion gene MLL4-GPS2, the expression of which promotes independent growth.
24943844 Posttranslational modification of GPS2 by SUMOylation may serve as a key factor that regulates the function of GPS2 in vivo.
24223774 GPS2 is required for the association of viral NS5A with VAP-A and hepatitis C virus replication.
23221346 expression of the transcriptional corepressor complex subunits GPS2 and SMRT was significantly reduced in obese adipose tissue, inversely correlated to inflammatory status
22190034 HIV-1 Vif is identified to have a physical interaction with G protein pathway suppressor 2 (GPS2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20159957 metabolically important coregulator GPS2 functions as a hitherto unrecognized transrepression mediator of interactions between SUMOylated nuclear receptors and the N-CoR corepressor complex
19917673 Results show for the first time that GPS-2 is differentially methylated at a site that lacks known methylation motifs and that the methylation state is detected by the immune system
19858209 G protein pathway suppressor 2 (GPS2) is a transcriptional corepressor important for estrogen receptor alpha-mediated transcriptional regulation.
19481530 Data describe the requirement of GPS2 for ABCG1 gene transcription and cholesterol efflux from macrophages, and implicate GPS2 in facilitating LXRalpha/beta recruitment to an ABCG1-specific promoter/enhancer unit upon ligand activation.
18218630 GPS2 interacts with RFX4_v3 to modulate transactivation of genes involved in brain morphogenesis, including Cx3Cl1
17895379 Direct interactions of GPS2 with hnf4alpha and farnesoid x receptor indicate alternative coregulator recruitment strategies to cause differential transcriptional outcomes in governing bile acid biosynthesis.
16122992 the GPS2 might function in concert with hMSH4-hMSH5 during the process of homologous recombination.
11931768 Results show that the N-CoR-HDAC3 complex inhibits JNK activation through the associated GPS2 subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP-1 function.

AA Sequence

MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQIL      1 - 70
KLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNR     71 - 140
PGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQL    141 - 210
RAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALH    211 - 280
PAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK                           281 - 327
//

Text Mined References (35)

PMID Year Title
26070566 2015 Exchange Factor TBL1 and Arginine Methyltransferase PRMT6 Cooperate in Protecting G Protein Pathway Suppressor 2 (GPS2) from Proteasomal Degradation.
25416956 2014 A proteome-scale map of the human interactome network.
25139254 2014 Identification of an MLL4-GPS2 fusion as an oncogenic driver of undifferentiated spindle cell sarcoma in a child.
24943844 2014 SUMOylation of GPS2 protein regulates its transcription-suppressing function.
24223774 2013 GPS2 is required for the association of NS5A with VAP-A and hepatitis C virus replication.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23221346 2013 SMRT-GPS2 corepressor pathway dysregulation coincides with obesity-linked adipocyte inflammation.
22190034 2011 Global landscape of HIV-human protein complexes.
20159957 2010 GPS2-dependent corepressor/SUMO pathways govern anti-inflammatory actions of LRH-1 and LXRbeta in the hepatic acute phase response.
19917673 2010 Differential arginine methylation of the G-protein pathway suppressor GPS-2 recognized by tumor-specific T cells in melanoma.
19858209 2009 G protein pathway suppressor 2 (GPS2) is a transcriptional corepressor important for estrogen receptor alpha-mediated transcriptional regulation.
19481530 2009 GPS2 is required for cholesterol efflux by triggering histone demethylation, LXR recruitment, and coregulator assembly at the ABCG1 locus.
18985028 2008 Hepatitis C virus infection protein network.
18218630 2008 G-protein pathway suppressor 2 (GPS2) interacts with the regulatory factor X4 variant 3 (RFX4_v3) and functions as a transcriptional co-activator.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17895379 2007 Involvement of corepressor complex subunit GPS2 in transcriptional pathways governing human bile acid biosynthesis.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16122992 2006 Formation of hMSH4-hMSH5 heterocomplex is a prerequisite for subsequent GPS2 recruitment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15159402 2004 Identification of interaction partners and substrates of the cyclin A1-CDK2 complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12628926 2003 Purification and functional characterization of the human N-CoR complex: the roles of HDAC3, TBL1 and TBLR1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11931768 2002 The N-CoR-HDAC3 nuclear receptor corepressor complex inhibits the JNK pathway through the integral subunit GPS2.
11689660 2001 Interaction of zyxin, a focal adhesion protein, with the e6 protein from human papillomavirus type 6 results in its nuclear translocation.
11486030 2001 AMF1 (GPS2) modulates p53 transactivation.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11119584 2001 Gps2, a protein partner for human papillomavirus E6 proteins.
10846067 2000 AMF-1/Gps2 binds p300 and enhances its interaction with papillomavirus E2 proteins.
9372953 1997 Functional interaction of a novel cellular protein with the papillomavirus E2 transactivation domain.
9325311 1997 A human suppressor of c-Jun N-terminal kinase 1 activation by tumor necrosis factor alpha.
8943324 1996 Two human cDNAs, including a homolog of Arabidopsis FUS6 (COP11), suppress G-protein- and mitogen-activated protein kinase-mediated signal transduction in yeast and mammalian cells.