Property Summary

NCBI Gene PubMed Count 25
PubMed Score 38.26
PubTator Score 31.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3163 7.7e-06

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.200 7.7e-06

Protein-protein Interaction (2)

Gene RIF (5)

PMID Text
23408908 We analyzed whether CSN1 alone can increase DEN1 degradation in HeLa cells.these data suggest that the COP9 signalosome supports proteasome-dependent protein degradation of DEN1/DenA in fungi and in human cells.
22190034 HIV-1 Vpr is identified to have a physical interaction with G protein pathway suppressor 1 (GPS1; COPS1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22103747 An increased level of CSN1 and CSN5 as an important part of the ubiquitin proteasome system (UPS) might be associated with the pathophysiology of preeclampsia.
21604193 CSN1 inhibits c-Jun phosphorylation without affecting its protein stability.
11114242 The N-terminal half of CSN1/GPS1 is required to repress c-fos expression and to inhibit AP-1 and SRE transactivation, while the C-terminal half allows integration of the protein into the COP9 signalosome.

AA Sequence

MPLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASYSGLMRIERLQFIADHCPTL      1 - 70
RVEALKMALSFVQRTFNVDMYEEIHRKLSEATRSSLRELQNAPDAIPESGVEPPALDTAWVEATRKKALL     71 - 140
KLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSV    141 - 210
YLQNWSHVLSYVSKAESTPEIAEQRGERDSQTQAILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDF    211 - 280
PELLSPSNVAIYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKD    281 - 350
NLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLILEGLISARVDSH    351 - 420
SKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTN    421 - 490
M//

Text Mined References (34)

PMID Year Title
24421388 2014 Dynamic regulation of the COP9 signalosome in response to DNA damage.
23408908 2013 Control of multicellular development by the physically interacting deneddylases DEN1/DenA and COP9 signalosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22103747 2012 Altered expression of COP9 signalosome proteins in preeclampsia.
21604193 2011 CSN1 inhibits c-Jun phosphorylation and down-regulates ectopic expression of JNK1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19444310 2009 COP9 signalosome controls the Carma1-Bcl10-Malt1 complex upon T-cell stimulation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19141280 2009 Symmetrical modularity of the COP9 signalosome complex suggests its multifunctionality.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15304329 2004 Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12732143 2003 The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage.
12628923 2003 Protein kinase CK2 and protein kinase D are associated with the COP9 signalosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12324474 2002 Inositol 1,3,4-trisphosphate 5/6-kinase associates with the COP9 signalosome by binding to CSN1.
12220626 2002 Association of the mammalian proto-oncoprotein Int-6 with the three protein complexes eIF3, COP9 signalosome and 26S proteasome.
11337588 2001 Promotion of NEDD-CUL1 conjugate cleavage by COP9 signalosome.
11285227 2001 COP9 signalosome-specific phosphorylation targets p53 to degradation by the ubiquitin system.
11114242 2001 The subunit 1 of the COP9 signalosome suppresses gene expression through its N-terminal domain and incorporates into the complex through the PCI domain.
9535219 1998 A novel protein complex involved in signal transduction possessing similarities to 26S proteasome subunits.
8943324 1996 Two human cDNAs, including a homolog of Arabidopsis FUS6 (COP11), suppress G-protein- and mitogen-activated protein kinase-mediated signal transduction in yeast and mammalian cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.