Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.57
PubTator Score 3.10

Knowledge Summary

Patent (2,894)

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
aldosterone-producing adenoma 1.071 2.2e-02
esophageal adenocarcinoma 1.100 1.8e-02
gastric carcinoma -2.200 3.3e-02
group 4 medulloblastoma -1.100 1.3e-02
pancreatic ductal adenocarcinoma liver m... -1.278 9.8e-04

Gene RIF (1)

AA Sequence

MAIHKALVMCLGLPLFLFPGAWAQGHVPPGCSQGLNPLYYNLCDRSGAWGIVLEAVAGAGIVTTFVLTII      1 - 70
LVASLPFVQDTKKRSLLGTQVFFLLGTLGLFCLVFACVVKPDFSTCASRRFLFGVLFAICFSCLAAHVFA     71 - 140
LNFLARKNHGPRGWVIFTVALLLTLVEVIINTEWLIITLVRGSGEGGPQGNSSAGWAVASPCAIANMDFV    141 - 210
MALIYVMLLLLGAFLGAWPALCGRYKRWRKHGVFVLLTTATSVAIWVVWIVMYTYGNKQHNSPTWDDPTL    211 - 280
AIALAANAWAFVLFYVIPEVSQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAFSMDEPVA    281 - 350
AKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQ    351 - 420
AATPPKDGKNSQVFRNPYVWD                                                     421 - 441
//

Text Mined References (21)

PMID Year Title