Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.94
PubTator Score 5.70

Knowledge Summary

Patent (4,651)

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -2.900 1.5e-08
oligodendroglioma 1.300 1.2e-02
esophageal adenocarcinoma 1.800 2.4e-02
psoriasis -1.100 4.4e-06
osteosarcoma -1.322 6.1e-03
group 4 medulloblastoma -2.200 7.9e-06
glioblastoma -1.100 4.2e-02
atypical teratoid/rhabdoid tumor -1.700 1.6e-04
medulloblastoma, large-cell -3.200 5.8e-06
intraductal papillary-mucinous neoplasm ... 1.700 2.5e-02
lung cancer -1.100 4.3e-03
breast carcinoma -1.400 4.2e-05
subependymal giant cell astrocytoma -1.656 1.7e-02
Breast cancer -1.900 5.9e-06
lung carcinoma 1.600 7.4e-15
ovarian cancer 1.300 2.6e-02
pituitary cancer -2.700 6.6e-06
Down syndrome 1.300 5.2e-03

Gene RIF (3)

PMID Text
24404583 this study proposes that increased expression of GPRC5B contributes to the reduced insulin secretion and beta-cell viability observed in type-2 diabetes.
20935630 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALIT      1 - 70
LLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDETICSVRRFLWGVLFALCFSCL     71 - 140
LSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEWLVLTVLRDTRPACAYEPMDFVMALIYDMVL    141 - 210
LVVTLGLALFTLCGKFKRWKLNGAFLLITAFLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASG    211 - 280
WVFVIFHAIPEIHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGF    281 - 350
PNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW                     351 - 403
//

Text Mined References (23)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24729846 2014 G protein-coupled receptor, family C, group 5 (GPRC5B) downregulation in spinal cord neurons is involved in neuropathic pain.
24412205 2014 Intercellular transfer of GPRC5B via exosomes drives HGF-mediated outward growth.
24404583 2013 GPRC5B a putative glutamate-receptor candidate is negative modulator of insulin secretion.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23169819 2012 GPRC5B activates obesity-associated inflammatory signaling in adipocytes.
21557262 2011 Proteomic identification of exosomal LRG1: a potential urinary biomarker for detecting NSCLC.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10945465 2000 Molecular cloning and characterization of two novel retinoic acid-inducible orphan G-protein-coupled receptors (GPRC5B and GPRC5C).
10783259 2000 Sequence and expression pattern of a novel human orphan G-protein-coupled receptor, GPRC5B, a family C receptor with a short amino-terminal domain.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.