Property Summary

NCBI Gene PubMed Count 28
PubMed Score 33.65
PubTator Score 29.19

Knowledge Summary

Patent (13,444)

Expression

  Differential Expression (28)

 CSPA Cell Line (2)

Gene RIF (12)

PMID Text
25744720 Results show how GPRC5A deficiency leads to dysregulated EGFR and STAT3 signaling and lung tumorigenesis.
25311788 EGFR interacted with GPRC5A and phosphorylated it in two conserved double-tyrosine motifs, Y317/Y320 and Y347/ Y350, at the C-terminal tail of GPRC5A.
24984703 The interaction of miR-103a-3p with each of the two 5' UTR targets reduces the expression levels of both GPRC5A mRNA and GPRC5A protein in one normal epithelial and two pancreatic cancer cell lines.
24470238 Data indicate that in mammary tumors, the mRNA expression of GPRC5A significantly correlated with that of BRCA1.
23632812 RAI3 may contribute to the malignant progression of hepatocellular carcinoma
23154545 Decreased GPRC5A expression is associated with non-small cell lung cancers and lung inflammation.
20563252 Loss of GPRC5A is associated with lung adenocarcinomas.
19552806 analysis of RAI3 expression in normal and cancerous human breast tissue at both the mRNA and protein levels
19279407 Mechanisms underlying the induction of the putative human tumor suppressor GPRC5A are reported.
18000218 Gprc5a functions as a tumor suppressor in mouse lung, and human GPRC5A may share this property.
17055459 This evidence explains one of the mechanisms of the GPRC5A-regulated cell growth in some cancer cell lines.
15659406 RAI3 is a cell growth-promoting gene and a novel P53 transcriptional target

AA Sequence

MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFL      1 - 70
FLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVG     71 - 140
FSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHG    141 - 210
AHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVE    211 - 280
DAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY    281 - 350
EVKKEGS                                                                   351 - 357
//

Text Mined References (34)

PMID Year Title
25744720 2015 Lung Tumor Suppressor GPRC5A Binds EGFR and Restrains Its Effector Signaling.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25311788 2014 EGFR phosphorylates and inhibits lung tumor suppressor GPRC5A in lung cancer.
24984703 2014 MiR-103a-3p targets the 5' UTR of GPRC5A in pancreatic cells.
24470238 2014 High prevalence of GPRC5A germline mutations in BRCA1-mutant breast cancer patients.
23632812 2014 Overexpression of retinoic acid-induced protein 3 predicts poor prognosis for hepatocellular carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154545 2012 G-protein coupled receptor family C, group 5, member A (GPRC5A) expression is decreased in the adjacent field and normal bronchial epithelia of patients with chronic obstructive pulmonary disease and non-small-cell lung cancer.
21269460 2011 Initial characterization of the human central proteome.
20563252 2010 A Gprc5a tumor suppressor loss of expression signature is conserved, prevalent, and associated with survival in human lung adenocarcinomas.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19552806 2009 Production and characterisation of monoclonal antibodies against RAI3 and its expression in human breast cancer.
19279407 2009 Mechanisms underlying the induction of the putative human tumor suppressor GPRC5A by retinoic acid.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18000218 2007 Identification of the retinoic acid-inducible Gprc5a as a new lung tumor suppressor gene.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17055459 2006 Novel reciprocal regulation of cAMP signaling and apoptosis by orphan G-protein-coupled receptor GPRC5A gene expression.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15659406 2005 Integrative genomics revealed RAI3 is a cell growth-promoting gene and a novel P53 transcriptional target.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14706456 2004 Characterization of the murine orphan G-protein-coupled receptor gene Rai3 and its regulation by retinoic acid.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10945465 2000 Molecular cloning and characterization of two novel retinoic acid-inducible orphan G-protein-coupled receptors (GPRC5B and GPRC5C).
10783259 2000 Sequence and expression pattern of a novel human orphan G-protein-coupled receptor, GPRC5B, a family C receptor with a short amino-terminal domain.
9857033 1998 Molecular cloning and characterization of a novel retinoic acid-inducible gene that encodes a putative G protein-coupled receptor.
8832110 1996 Identification by differential display of a mRNA specifically induced by 12-O-tetradecanoylphorbol-13-acetate (TPA) in T84 human colon carcinoma cells.