Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.00
PubTator Score 2.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.500 9.1e-05
astrocytic glioma -2.200 4.3e-03
atypical teratoid / rhabdoid tumor -1.500 1.3e-04
Breast cancer -1.700 4.5e-15
breast carcinoma -1.200 1.8e-28
ependymoma -3.000 7.5e-03
glioblastoma -1.100 3.0e-06
interstitial cystitis -1.100 1.2e-03
intraductal papillary-mucinous carcinoma... -1.700 4.9e-04
intraductal papillary-mucinous neoplasm ... -1.800 1.0e-03
invasive ductal carcinoma -1.235 1.2e-03
lung carcinoma 1.900 1.4e-31
medulloblastoma, large-cell -1.900 7.6e-05
oligodendroglioma -1.600 2.6e-02
ovarian cancer -3.500 4.9e-13
Pick disease -1.400 1.5e-02
subependymal giant cell astrocytoma -1.621 1.1e-02

Gene RIF (2)

AA Sequence

MTGAEIEPSAQAKPEKKAGEEVIAGPERENDVPLVVRPKVRTQATTGARPKTETKSVPAARPKTEAQAMS      1 - 70
GARPKTEVQVMGGARPKTEAQGITGARPKTDARAVGGARSKTDAKAIPGARPKDEAQAWAQSEFGTEAVS     71 - 140
QAEGVSQTNAVAWPLATAESGSVTKSKGLSMDRELVNVDAETFPGTQGQKGIQPWFGPGEETNMGSWCYS    141 - 210
RPRAREEASNESGFWSADETSTASSFWTGEETSVRSWPREESNTRSRHRAKHQTNPRSRPRSKQEAYVDS    211 - 280
WSGSEDEASNPFSFWVGENTNNLFRPRVREEANIRSKLRTNREDCFESESEDEFYKQSWVLPGEEANSRF    281 - 350
RHRDKEDPNTALKLRAQKDVDSDRVKQEPRFEEEVIIGSWFWAEKEASLEGGASAICESEPGTEEGAIGG    351 - 420
SAYWAEEKSSLGAVAREEAKPESEEEAIFGSWFWDRDEACFDLNPCPVYKVSDRFRDAAEELNASSRPQT    421 - 490
WDEVTVEFKPGLFHGVGFRSTSPFGIPEEASEMLEAKPKNLELSPEGEEQESLLQPDQPSPEFTFQYDPS    491 - 560
YRSVREIREHLRARESAESESWSCSCIQCELKIGSEEFEEFLLLMDKIRDPFIHEISKIAMGMRSASQFT    561 - 630
RDFIRDSGVVSLIETLLNYPSSRVRTSFLENMIHMAPPYPNLNMIETFICQVCEETLAHSVDSLEQLTGI    631 - 700
RMLRHLTMTIDYHTLIANYMSGFLSLLTTANARTKFHVLKMLLNLSENPAVAKKLFSAKALSIFVGLFNI    701 - 770
EETNDNIQIVIKMFQNISNIIKSGKMSLIDDDFSLEPLISAFREFEELAKQLQAQIDNQNDPEVGQQS      771 - 838
//

Text Mined References (19)

PMID Year Title