Property Summary

NCBI Gene PubMed Count 22
PubMed Score 7.92
PubTator Score 29.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
adrenocortical carcinoma -1.172 2.3e-02
adult high grade glioma -2.200 2.0e-06
astrocytic glioma -2.700 4.4e-03
atypical teratoid / rhabdoid tumor -2.800 4.7e-08
Breast cancer -3.300 2.6e-02
breast carcinoma -1.600 3.3e-37
colon cancer -1.800 3.7e-02
Common variable immunodeficiency -1.342 4.0e-03
cystic fibrosis 1.588 1.1e-04
ductal carcinoma in situ -1.200 4.1e-04
ependymoma -3.300 5.4e-03
glioblastoma -1.700 2.9e-06
group 3 medulloblastoma -1.500 1.1e-02
intraductal papillary-mucinous adenoma (... -1.500 2.8e-03
intraductal papillary-mucinous carcinoma... -1.800 9.3e-04
intraductal papillary-mucinous neoplasm ... -1.800 9.7e-03
invasive ductal carcinoma -1.700 2.0e-04
lung adenocarcinoma -1.200 1.1e-08
lung cancer -2.200 7.9e-05
lung carcinoma 2.200 3.5e-29
medulloblastoma, large-cell -4.600 1.9e-06
non-small cell lung cancer -1.470 1.8e-19
oligodendroglioma -2.000 2.3e-02
ovarian cancer -4.300 7.7e-24
primitive neuroectodermal tumor -1.900 1.1e-04
psoriasis -1.700 1.7e-09
sarcoidosis -1.300 4.1e-03
subependymal giant cell astrocytoma -2.686 1.3e-03

Gene RIF (12)

AA Sequence

MTGAEIESGAQVKPEKKPGEEVVGGAEIENDVPLVVRPKVRTQAQIMPGARPKNKSKVMPGASTKVETSA      1 - 70
VGGARPKSKAKAIPVSRFKEEAQMWAQPRFGAERLSKTERNSQTNIIASPLVSTDSVLVAKTKYLSEDRE     71 - 140
LVNTDTESFPRRKAHYQAGFQPSFRSKEETNMGSWCCPRPTSKQEASPNSDFKWVDKSVSSLFWSGDEVT    141 - 210
AKFHPGNRVKDSNRSMHMANQEANTMSRSQTNQELYIASSSGSEDESVKTPWFWARDKTNTWSGPREDPN    211 - 280
SRSRFRSKKEVYVESSSGSEHEDHLESWFGAGKEAKFRSKMRAGKEANNRARHRAKREACIDFMPGSIDV    281 - 350
IKKESCFWPEENANTFSRPMIKKEARARAMTKEEAKTKARARAKQEARSEEEALIGTWFWATDESSMADE    351 - 420
ASIESSLQVEDESIIGSWFWTEEEASMGTGASSKSRPRTDGERIGDSLFGAREKTSMKTGAEATSESILA    421 - 490
ADDEQVIIGSWFWAGEEVNQEAEEETIFGSWFWVIDAASVESGVGVSCESRTRSEEEEVIGPWFWSGEQV    491 - 560
DIEAGIGEEARPGAEEETIFGSWFWAENQTYMDCRAETSCDTMQGAEEEEPIIGSWFWTRVEACVEGDVN    561 - 630
SKSSLEDKEEAMIPCFGAKEEVSMKHGTGVRCRFMAGAEETNNKSCFWAEKEPCMYPAGGGSWKSRPEEE    631 - 700
EDIVNSWFWSRKYTKPEAIIGSWLWATEESNIDGTGEKAKLLTEEETIINSWFWKEDEAISEATDREESR    701 - 770
PEAEEGDIIGSWFWAGEEDRLEPAAETREEDRLAAEKEGIVGSWFGAREETIRREAGSCSKSSPKAEEEE    771 - 840
VIIGSWFWEEEASPEAVAGVGFESKPGTEEEEITVGSWFWPEEEASIQAGSQAVEEMESETEEETIFGSW    841 - 910
FWDGKEVSEEAGPCCVSKPEDDEEMIVESWFWSRDKAIKETGTVATCESKPENEEGAIVGSWFEAEDEVD    911 - 980
NRTDNGSNCGSRTLADEDEAIVGSWFWAGDEAHFESNPSPVFRAICRSTCSVEQEPDPSRRPQSWEEVTV    981 - 1050
QFKPGPWGRVGFPSISPFRFPKEAASLFCEMFGGKPRNMVLSPEGEDQESLLQPDQPSPEFPFQYDPSYR   1051 - 1120
SVQEIREHLRAKESTEPESSSCNCIQCELKIGSEEFEELLLLMEKIRDPFIHEISKIAMGMRSASQFTRD   1121 - 1190
FIRDSGVVSLIETLLNYPSSRVRTSFLENMIRMAPPYPNLNIIQTYICKVCEETLAYSVDSPEQLSGIRM   1191 - 1260
IRHLTTTTDYHTLVANYMSGFLSLLATGNAKTRFHVLKMLLNLSENLFMTKELLSAEAVSEFIGLFNREE   1261 - 1330
TNDNIQIVLAIFENIGNNIKKETVFSDDDFNIEPLISAFHKVEKFAKELQGKTDNQNDPEGDQEN        1331 - 1395
//

Text Mined References (22)

PMID Year Title