Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.02
PubTator Score 0.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Chromosome 1q21.1 deletion syndrome 12 0.0 5.0

Expression

AA Sequence

MSFLIDSSIMITSQILFFGFGWLFFMRQLFKDYEIRQYVVQVIFSVTFAFSCTMFELIIFEILGVLNSSS      1 - 70
RYFHWKMNLCVILLILVFMVPFYIGYFIVSNIRLLHKQRLLFSCLLWLTFMYFFWKLGDPFPILSPKHGI     71 - 140
LSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMA    141 - 210
RRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKT    211 - 280
FKGKYFNFLGYFFSIYCVWKIFMATINIVFDRVGKTDPVTRGIEITVNYLGIQFDVKFWSQHISFILVGI    281 - 350
IIVTSIRGLLITLTKFFYAISSSKSSNVIVLLLAQIMGMYFVSSVLLIRMSMPLEYRTIITEVLGELQFN    351 - 420
FYHRWFDVIFLVSALSSILFLYLAHKQAPEKQMAP                                       421 - 455
//

Text Mined References (14)

PMID Year Title