Property Summary

Ligand Count 103
NCBI Gene PubMed Count 7
PubMed Score 29.63
PubTator Score 7.79

Knowledge Summary

Patent (3,711)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.100 9.4e-08
Astrocytoma, Pilocytic -3.000 7.1e-05
atypical teratoid / rhabdoid tumor -3.800 2.0e-08
ependymoma -2.700 5.5e-04
glioblastoma -2.400 1.5e-04
medulloblastoma -1.900 3.3e-02
medulloblastoma, large-cell -3.400 6.0e-03
oligodendroglioma -2.500 7.4e-04
osteosarcoma -3.356 2.4e-07
pediatric high grade glioma -3.000 1.9e-04

Gene RIF (1)

AA Sequence

MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFRKLQTTSNAFI      1 - 70
VNGCAADLSVCALWMPQEAVLGLLPTGSAEPPADWDGAGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYL     71 - 140
LITRAPATYQALYQRRHTAGMLALSWALALGLVLLLPPWAPRPGAAPPRVHYPALLAAAALLAQTALLLH    141 - 210
CYLGIVRRVRVSVKRVSVLNFHLLHQLPGCAAAAAAFPGAQHAPGPGGAAHPAQAQPLPPALHPRRAQRR    211 - 280
LSGLSVLLLCCVFLLATQPLVWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSV    281 - 350
LPGVGDAAAAAVAATAVPAVSQAQLGTRAAGQHW                                        351 - 384
//

Text Mined References (9)

PMID Year Title