Property Summary

Ligand Count 1
NCBI Gene PubMed Count 15
PubMed Score 14.15
PubTator Score 11.61

Knowledge Summary

Patent (3,246)

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -2.600 9.9e-16
esophageal adenocarcinoma -2.700 2.3e-02
interstitial cystitis -2.400 3.3e-03
lung adenocarcinoma 1.200 2.2e-05
malignant mesothelioma -5.000 8.8e-10
non-small cell lung cancer 3.792 4.4e-17
pancreatic cancer 1.700 7.3e-04
psoriasis 1.200 1.6e-03

Gene RIF (9)

AA Sequence

MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYLIIFVASILLNGLAVWIFFHI      1 - 70
RNKTSFIFYLKNIVVADLIMTLTFPFRIVHDAGFGPWYFKFILCRYTSVLFYANMYTSIVFLGLISIDRY     71 - 140
LKVVKPFGDSRMYSITFTKVLSVCVWVIMAVLSLPNIILTNGQPTEDNIHDCSKLKSPLGVKWHTAVTYV    141 - 210
NSCLFVAVLVILIGCYIAISRYIHKSSRQFISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSHL    211 - 280
DRLLDESAQKILYYCKEITLFLSACNVCLDPIIYFFMCRSFSRRLFKKSNIRTRSESIRSLQSVRRSEVR    281 - 350
IYYDYTDV                                                                  351 - 358
//

Text Mined References (16)

PMID Year Title