Property Summary

NCBI Gene PubMed Count 17
PubMed Score 21.13
PubTator Score 9.03

Knowledge Summary

Patent (4,530)

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.600 1.1e-03
cystic fibrosis 1.024 2.8e-04
ependymoma -1.800 3.4e-02
glioblastoma -1.100 9.5e-03
group 4 medulloblastoma -1.300 2.7e-03
interstitial cystitis -1.600 2.1e-03
malignant mesothelioma -1.800 3.2e-06
medulloblastoma, large-cell -2.400 1.6e-03
pituitary cancer 2.100 9.2e-05
subependymal giant cell astrocytoma -1.766 3.5e-02

Gene RIF (4)

AA Sequence

MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRS      1 - 70
AICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLA     71 - 140
VICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVH    141 - 210
DRRKMKPVQFVAAVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKME    211 - 280
KRISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCF    281 - 350
STTLLYCRKSRLPREPYCVI                                                      351 - 370
//

Text Mined References (18)

PMID Year Title