Property Summary

Ligand Count 1
NCBI Gene PubMed Count 9
PubMed Score 221.49
PubTator Score 18.60

Knowledge Summary

Patent (8,952)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.200 5.9e-04
astrocytic glioma -2.600 1.7e-03
Astrocytoma, Pilocytic -2.500 2.2e-07
atypical teratoid / rhabdoid tumor -2.000 1.4e-05
ependymoma -2.900 2.6e-03
glioblastoma -2.200 6.7e-07
medulloblastoma -1.200 7.5e-03
medulloblastoma, large-cell -2.100 9.8e-05
oligodendroglioma -2.600 4.2e-03
subependymal giant cell astrocytoma -2.997 6.6e-03

Gene RIF (2)

AA Sequence

MVPHLLLLCLLPLVRATEPHEGRADEQSAEAALAVPNASHFFSWNNYTFSDWQNFVGRRRYGAESQNPTV      1 - 70
KALLIVAYSFIIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMITLLNTPFTLVRFVNSTWIFG     71 - 140
KGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPRISITKGVIYIAVIWTMATFFSLPHAICQKL    141 - 210
FTFKYSEDIVRSLCLPDFPEPADLFWKYLDLATFILLYILPLLIISVAYARVAKKLWLCNMIGDVTTEQY    211 - 280
FALRRKKKKTIKMLMLVVVLFALCWFPLNCYVLLLSSKVIRTNNALYFAFHWFAMSSTCYNPFIYCWLNE    281 - 350
NFRIELKALLSMCQRPPKPQEDRPPSPVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPIV    351 - 420
TMS                                                                       421 - 423
//

Text Mined References (11)

PMID Year Title