Property Summary

NCBI Gene PubMed Count 9
PubMed Score 206.65
PubTator Score 18.60

Knowledge Summary

Patent (8,952)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.600 1.7e-03
ependymoma -2.900 2.6e-03
oligodendroglioma -2.600 4.2e-03
glioblastoma -2.500 2.9e-08
medulloblastoma -1.200 7.5e-03
atypical teratoid / rhabdoid tumor -2.000 1.4e-05
medulloblastoma, large-cell -2.100 9.8e-05
pediatric high grade glioma -2.400 5.0e-07
pilocytic astrocytoma -2.500 1.7e-07
subependymal giant cell astrocytoma -2.997 6.6e-03

Gene RIF (2)

PMID Text
20200545 results suggest that the 20 additional aminoacids within GPR83 isoform-4 are involved in Treg induction during inflammatory immune responses
16785516 GPR83 is 2- to 7-fold up-regulated in all indvidual human CD4+CD25+ T regulatory cell populations analyzed and is directly linked to Foxp3 expression.

AA Sequence

MVPHLLLLCLLPLVRATEPHEGRADEQSAEAALAVPNASHFFSWNNYTFSDWQNFVGRRRYGAESQNPTV      1 - 70
KALLIVAYSFIIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMITLLNTPFTLVRFVNSTWIFG     71 - 140
KGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPRISITKGVIYIAVIWTMATFFSLPHAICQKL    141 - 210
FTFKYSEDIVRSLCLPDFPEPADLFWKYLDLATFILLYILPLLIISVAYARVAKKLWLCNMIGDVTTEQY    211 - 280
FALRRKKKKTIKMLMLVVVLFALCWFPLNCYVLLLSSKVIRTNNALYFAFHWFAMSSTCYNPFIYCWLNE    281 - 350
NFRIELKALLSMCQRPPKPQEDRPPSPVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPIV    351 - 420
TMS                                                                       421 - 423
//

Text Mined References (11)

PMID Year Title
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
20200545 2010 Inflammation in vivo is modulated by GPR83 isoform-4 but not GPR83 isoform-1 expression in regulatory T cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16785516 2006 G protein-coupled receptor 83 overexpression in naive CD4+CD25- T cells leads to the induction of Foxp3+ regulatory T cells in vivo.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11060465 2000 Cloning and chromosomal mapping of the mouse and human genes encoding the orphan glucocorticoid-induced receptor (GPR83).
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10760605 2000 Y-receptor-like genes GPR72 and GPR73: molecular cloning, genomic organisation and assignment to human chromosome 11q21.1 and 2p14 and mouse chromosome 9 and 6.