Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.16
PubTator Score 0.51

Knowledge Summary

Patent (4,092)

Expression

  Differential Expression (10)

Disease log2 FC p
hepatocellular carcinoma 1.200 2.4e-03
pancreatic cancer 1.200 6.5e-03
osteosarcoma 1.448 4.0e-02
glioblastoma 2.100 8.1e-03
interstitial cystitis 1.400 1.8e-02
adult high grade glioma 2.300 3.0e-04
pilocytic astrocytoma 2.000 1.4e-04
primary Sjogren syndrome 1.300 9.7e-03
pancreatic carcinoma 1.200 6.5e-03
nasopharyngeal carcinoma -1.300 1.2e-02

AA Sequence

MNNNTTCIQPSMISSMALPIIYILLCIVGVFGNTLSQWIFLTKIGKKTSTHIYLSHLVTANLLVCSAMPF      1 - 70
MSIYFLKGFQWEYQSAQCRVVNFLGTLSMHASMFVSLLILSWIAISRYATLMQKDSSQETTSCYEKIFYG     71 - 140
HLLKKFRQPNFARKLCIYIWGVVLGIIIPVTVYYSVIEATEGEESLCYNRQMELGAMISQIAGLIGTTFI    141 - 210
GFSFLVVLTSYYSFVSHLRKIRTCTSIMEKDLTYSSVKRHLLVIQILLIVCFLPYSIFKPIFYVLHQRDN    211 - 280
CQQLNYLIETKNILTCLASARSSTDPIIFLLLDKTFKKTLYNLFTKSNSAHMQSYG                  281 - 336
//

Text Mined References (7)

PMID Year Title
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11574155 2001 Discovery and mapping of ten novel G protein-coupled receptor genes.