Property Summary

NCBI Gene PubMed Count 24
PubMed Score 50.79
PubTator Score 35.21

Knowledge Summary

Patent (3,955)

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.162 5.4e-03
tuberculosis and treatment for 3 months -1.400 3.3e-06
breast carcinoma 1.500 3.0e-06
fibroadenoma 1.100 7.2e-03
sonic hedgehog group medulloblastoma 1.500 7.4e-03
non primary Sjogren syndrome sicca 1.100 1.5e-02
psoriasis 2.000 5.2e-114
invasive ductal carcinoma 1.206 1.8e-04

Gene RIF (14)

PMID Text
26206859 The deconstruction of OGR1-dependent signaling may aid our understanding of mucosal inflammation mechanisms
24375028 Provide evidence for the roles of OGR1 and ASIC1a in the regulation of intestinal passive Mg(2+) absorption.
23222714 the expression of OGR1 in myeloid-derived cells, especially in double positive cells, was required for prostate tumor cell-induced immunosuppression.
22835475 The involvement of ovarian cancer G-protein-coupled receptor 1 in acidic extracellular environment may be an underlying mechanism responsible for bone pain in osteoporosis or bone metastasis without clinically proved fractures.
22508039 OGR1 activation increased intracellular calcium in transfected HEK293 cells.
21907704 extracellular acidification induces CTGF production through the OGR1/G(q/11) protein and inositol-1,4,5-trisphosphate-induced Ca(2+) mobilization in human airway smooth muscle cells.
21740742 It indicated that OGR1 may be a tumor suppressor gene for ovarian cancer.
20622109 acidic pH-induced vascular actions of aortic smooth muscle cells can be dissected to OGR1-dependent and -independent pathways: COX-2 expression, PGI(2) production, and MKP-1 expression are mediated by OGR1, but PAI-1 expression is not.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18302504 OGR1/G(q/11)/phospholipase C/protein kinase C pathway regulates osteoblastic COX-2 induction and subsequent PGE(2) production in response to acidic circumstances
17728215 OGR1 is a novel metastasis suppressor gene for prostate cancer. OGR1's constitutive activity via G alpha(i) contributes to its inhibitory effect on cell migration in vitro.
16087674 cAMP accumulation may occur through OGR1-mediated stimulation of the phospholipase C/cyclooxygenase/PGI(2) pathway
15665078 OGR1 was found to evoke strong pH-dependent responses as measured by inositol phosphate accumulation.
12955148 ovarian cancer G-protein-coupled receptor 1 (OGR1), previously described as a receptor for sphingosylphosphorylcholine, acts as a proton-sensing receptor stimulating inositol phosphate formation

AA Sequence

MGNITADNSSMSCTIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYLCNLTVADLFY      1 - 70
ICSLPFWLQYVLQHDNWSHGDLSCQVCGILLYENIYISVGFLCCISVDRYLAVAHPFRFHQFRTLKAAVG     71 - 140
VSVVIWAKELLTSIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLLASYQGILR    141 - 210
AVRRSHGTQKSRKDQIQRLVLSTVVIFLACFLPYHVLLLVRSVWEASCDFAKGVFNAYHFSLLLTSFNCV    211 - 280
ADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQT    281 - 350
PNSPGSGGFPTGRLA                                                           351 - 365
//

Text Mined References (28)

PMID Year Title
26206859 2015 The pH-sensing receptor OGR1 improves barrier function of epithelial cells and inhibits migration in an acidic environment.
24375028 2014 The roles of acid-sensing ion channel 1a and ovarian cancer G protein-coupled receptor 1 on passive Mg2+ transport across intestinal epithelium-like Caco-2 monolayers.
23222714 2014 Role of OGR1 in myeloid-derived cells in prostate cancer.
22835475 2012 Ovarian cancer G-protein-coupled receptor 1 induces the expression of the pain mediator prostaglandin E2 in response to an acidic extracellular environment in human osteoblast-like cells.
22508039 2012 The proton-activated G protein coupled receptor OGR1 acutely regulates the activity of epithelial proton transport proteins.
21907704 2011 Extracellular acidification induces connective tissue growth factor production through proton-sensing receptor OGR1 in human airway smooth muscle cells.
21740742 2011 Effects of ovarian cancer G protein coupled receptor 1 on the proliferation, migration, and adhesion of human ovarian cancer cells.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20622109 2010 Ovarian cancer G protein-coupled receptor 1-dependent and -independent vascular actions to acidic pH in human aortic smooth muscle cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18302504 2008 Cyclooxygenase-2 expression and prostaglandin E2 production in response to acidic pH through OGR1 in a human osteoblastic cell line.
17728215 2007 Ovarian cancer G protein-coupled receptor 1, a new metastasis suppressor gene in prostate cancer.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16508674 2006 Retraction. Sphingosylphosphorylcholine is a ligand for ovarian cancer G-protein-coupled receptor 1.
16087674 2005 Prostaglandin I(2) production and cAMP accumulation in response to acidic extracellular pH through OGR1 in human aortic smooth muscle cells.
15665078 2005 Differential proton sensitivity of related G protein-coupled receptors T cell death-associated gene 8 and G2A expressed in immune cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14567679 2003 The G protein-coupled receptor GPR4 suppresses ERK activation in a ligand-independent manner.
12955148 2003 Proton-sensing G-protein-coupled receptors.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12069813 2002 Sphingosylphosphorylcholine and lysophosphatidylcholine: G protein-coupled receptors and receptor-mediated signal transduction.
10806476 2000 Sphingosylphosphorylcholine is a ligand for ovarian cancer G-protein-coupled receptor 1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8661159 1996 Identification of human OGR1, a novel G protein-coupled receptor that maps to chromosome 14.
7498459 1995 Cloning, sequencing and tissue distribution of two related G protein-coupled receptor candidates expressed prominently in human lung tissue.