Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.85
PubTator Score 8.39

Knowledge Summary

Patent (1,907)


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6


Gene RIF (4)

AA Sequence

ETSEFLEQQLTSDIIMSDSYLRPAASPRLES                                           421 - 451

Text Mined References (13)

PMID Year Title