Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.29
PubTator Score 7.44

Knowledge Summary

Patent (4,528)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.000 9.4e-03
ependymoma -2.100 1.8e-02
oligodendroglioma -2.100 1.1e-02
glioblastoma -2.300 7.9e-04
osteosarcoma 1.402 2.0e-06
medulloblastoma -2.400 7.8e-05
atypical teratoid / rhabdoid tumor -2.300 4.3e-05
primitive neuroectodermal tumor -2.100 1.6e-02
pediatric high grade glioma -1.200 1.2e-02
pilocytic astrocytoma -1.300 4.7e-03
pituitary cancer 1.500 1.1e-02

Gene RIF (3)

PMID Text
22487033 The GPR6 gene influences the reinforcement learning rate in a computational, neurogenetic model.
20677014 Observational study of gene-disease association. (HuGE Navigator)
12649592 control of gene expression in vascular endothelial cells in the presence of fluid shear stress and determines that it is not a sphingosine 1-phosphate receptor

AA Sequence

MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLP      1 - 70
AVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETV     71 - 140
SLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCL    141 - 210
AERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGT    211 - 280
LAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQS    281 - 350
KVPFRSRSPSEV                                                              351 - 362
//

Text Mined References (13)

PMID Year Title
22487033 2012 How much of reinforcement learning is working memory, not reinforcement learning? A behavioral, computational, and neurogenetic analysis.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19286662 2009 Lipid G protein-coupled receptor ligand identification using beta-arrestin PathHunter assay.
19059244 2009 Constitutively active GPR6 is located in the intracellular compartments.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12649592 2003 Fluid shear stress differentially regulates gpr3, gpr6, and gpr12 expression in human umbilical vein endothelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220620 2002 Sphingosine 1-phosphate is a ligand of the human gpr3, gpr6 and gpr12 family of constitutively active G protein-coupled receptors.
8530049 1995 Molecular cloning and chromosomal localization of human genes encoding three closely related G protein-coupled receptors.
7832990 1995 Isolation of three novel human genes encoding G protein-coupled receptors.