Property Summary

Ligand Count 42
NCBI Gene PubMed Count 105
PubMed Score 160.64
PubTator Score 127.89

Knowledge Summary

Patent (3,635)


  Disease (3)

Disease Target Count Z-score Confidence
Neoplasms 63 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 6.9e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6


  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.212 6.9e-07

Gene RIF (48)

AA Sequence

CCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG                                   281 - 319

Text Mined References (105)

PMID Year Title