Property Summary

Ligand Count 13
NCBI Gene PubMed Count 7
PubMed Score 5.65
PubTator Score 1.49

Knowledge Summary

Patent (1,781)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.600 1.7e-03
atypical teratoid / rhabdoid tumor 1.700 8.0e-04
glioblastoma 1.500 8.1e-04
medulloblastoma 1.200 2.9e-02
medulloblastoma, large-cell 2.400 1.0e-05
osteosarcoma 1.047 5.1e-04
ovarian cancer 1.900 3.3e-14

Gene RIF (2)

AA Sequence

MNESRWTEWRILNMSSGIVNVSERHSCPLGFGHYSVVDVCIFETVVIVLLTFLIIAGNLTVIFVFHCAPL      1 - 70
LHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLHYSTGVHESLTCQVFGYIISVLKSVSMACLACISVDRY     71 - 140
LAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGWGKPGYHGDIFEWCATSWLTSAYFTGFIVCL    141 - 210
LYAPAAFVVCFTYFHIFKICRQHTKEINDRRARFPSHEVDSSRETGHSPDRRYAMVLFRITSVFYMLWLP    211 - 280
YIIYFLLESSRVLDNPTLSFLTTWLAISNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCMCVKDQEAQEP    281 - 350
KPRKRANSCSI                                                               351 - 361
//

Text Mined References (7)

PMID Year Title