Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.92
PubTator Score 1.49

Knowledge Summary

Patent (1,781)

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.047 5.1e-04
atypical teratoid / rhabdoid tumor 1.700 8.0e-04
glioblastoma 1.500 8.1e-04
medulloblastoma 1.200 2.9e-02
medulloblastoma, large-cell 2.400 1.0e-05
adult high grade glioma 1.600 1.7e-03
ovarian cancer 1.900 3.3e-14

Gene RIF (2)

PMID Text
25738228 Data show that G protein-coupled receptor 52 (Gpr52) modulates huntingtin protein (Htt) levels in the striatal cells in vitro and in vivo.
23333304 HIV-1 Vif downregulates the expression of G protein-coupled receptor 52 (GPR52) in Vif-expression T cells

AA Sequence

MNESRWTEWRILNMSSGIVNVSERHSCPLGFGHYSVVDVCIFETVVIVLLTFLIIAGNLTVIFVFHCAPL      1 - 70
LHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLHYSTGVHESLTCQVFGYIISVLKSVSMACLACISVDRY     71 - 140
LAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGWGKPGYHGDIFEWCATSWLTSAYFTGFIVCL    141 - 210
LYAPAAFVVCFTYFHIFKICRQHTKEINDRRARFPSHEVDSSRETGHSPDRRYAMVLFRITSVFYMLWLP    211 - 280
YIIYFLLESSRVLDNPTLSFLTTWLAISNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCMCVKDQEAQEP    281 - 350
KPRKRANSCSI                                                               351 - 361
//

Text Mined References (6)

PMID Year Title
25738228 2015 A striatal-enriched intronic GPCR modulates huntingtin levels and toxicity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9931487 1999 Identification and cloning of three novel human G protein-coupled receptor genes GPR52, PsiGPR53 and GPR55: GPR55 is extensively expressed in human brain.