Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.38
PubTator Score 1.17

Knowledge Summary

Patent (1,409)

Gene RIF (2)

AA Sequence

MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLRCRPVAVDVLLLNLTASDLLLLLFLPF      1 - 70
RMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACW     71 - 140
LLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFWKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWI    141 - 210
LGRGGSHRRQRRVAGLVAATLLNFLVCFGPYNVSHVVGYICGESPVWRIYVTLLSTLNSCVDPFVYYFSS    211 - 280
SGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAEN        281 - 346
//

Text Mined References (8)

PMID Year Title