Property Summary

NCBI Gene PubMed Count 29
PubMed Score 42.53
PubTator Score 33.06

Knowledge Summary

Patent (3,177)

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -4.700 1.0e-08
active Crohn's disease 2.682 9.8e-03
astrocytoma -1.300 1.6e-05
Astrocytoma, Pilocytic -2.600 1.3e-04
atypical teratoid / rhabdoid tumor -2.700 1.1e-03
chronic kidney disease 1.100 3.8e-02
Down syndrome 1.600 2.5e-03
ductal carcinoma in situ 1.600 3.0e-03
Endometriosis -1.467 1.8e-02
ependymoma -1.500 6.6e-03
glioblastoma multiforme -1.100 2.3e-04
group 4 medulloblastoma -3.300 1.2e-05
head and neck cancer 1.300 3.6e-03
interstitial cystitis -1.100 1.9e-02
intraductal papillary-mucinous adenoma (... -1.500 3.4e-03
lung adenocarcinoma 1.267 1.2e-02
lung cancer 3.600 3.6e-05
medulloblastoma, large-cell -3.100 2.3e-04
non-small cell lung cancer 1.070 1.3e-05
oligodendroglioma -2.200 2.7e-07
ovarian cancer -2.000 5.4e-04
pancreatic ductal adenocarcinoma liver m... -1.669 7.9e-04
primitive neuroectodermal tumor -1.800 3.0e-02
subependymal giant cell astrocytoma -5.282 9.9e-03

Protein-protein Interaction (9)

Gene RIF (14)

AA Sequence

MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRAR      1 - 70
APREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPT     71 - 140
ALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGW    141 - 210
TIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNL    211 - 280
AVMCIVCHNYYMRSISNSLLANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTF    281 - 350
TLCALCIDRFRAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGRAPAERCI    351 - 420
IKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKACTRGNKRQIQLESQM    421 - 490
NCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFFKSCVTPVLLFCLCKPFSRAF    491 - 560
MECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIRREMSTFASVGTHC                     561 - 613
//

Text Mined References (29)

PMID Year Title