Property Summary

NCBI Gene PubMed Count 26
PubMed Score 40.13
PubTator Score 33.06

Knowledge Summary

Patent (3,177)

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -4.700 1.0e-08
astrocytoma -1.300 1.6e-05
glioblastoma multiforme -1.100 2.3e-04
oligodendroglioma -2.200 2.7e-07
ependymoma -1.500 6.6e-03
group 4 medulloblastoma -3.300 1.2e-05
atypical teratoid/rhabdoid tumor -3.400 2.0e-06
medulloblastoma, large-cell -3.100 2.3e-04
primitive neuroectodermal tumor -1.800 3.0e-02
chronic kidney disease 1.100 3.8e-02
pancreatic ductal adenocarcinoma liver m... -1.669 7.9e-04
non-small cell lung cancer 1.070 1.3e-05
intraductal papillary-mucinous adenoma (... -1.500 3.4e-03
lung cancer 5.000 7.8e-08
active Crohn's disease 2.682 9.8e-03
interstitial cystitis -1.200 3.4e-03
pilocytic astrocytoma -2.600 1.2e-04
subependymal giant cell astrocytoma -5.282 9.9e-03
lung adenocarcinoma 1.267 1.2e-02
Endometriosis -1.467 1.8e-02
ductal carcinoma in situ 1.600 3.0e-03
ovarian cancer -2.000 5.4e-04
Down syndrome 1.600 2.5e-03
head and neck cancer 1.300 3.6e-03

Protein-protein Interaction (10)

Gene RIF (13)

PMID Text
25977097 GPR37 was shown to be a component of the CASPR2-MUPP1 complex in brain.
25169131 GPR37 may play an important role in the pathogenesis of hepatocellular carcinoma by affecting the proliferation of HCC cells.
24290813 Positive role of GPR37 in the proliferation of multiple myeloma cells.
23690594 GPR37 and GPR37L1 are receptors for the neuroprotective and glioprotective factors prosaptide and prosaposin.
23251443 results suggested that some alleles in GPR37 were related to the deleterious effect of ASD. GPR37 is associated with the dopamine transporter to modulate dopamine uptake, and regulates behavioral responses to dopaminergic drugs
20424473 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19799451 GPR37 surface trafficking in heterologous cells can be greatly enhanced by N-terminal truncation, coexpression with other receptors, and coexpression with syntenin-1.
19218498 Data show that GPR37 overexpression can induce cellular autophagy, which may prevent the selective degeneration of GPR37-expressing neurons, as reported for Parkinson's and related neurodegenerative diseases.
18691389 Parkin-ko/Pael-R-tg mice represents an AR-JP mouse model displaying chronic and selective loss of catecholaminergic neurons.
16539653 These results suggest that 4-PBA suppresses ER stress by directly reducing the amount of misfolded protein, including Pael-R accumulated in the ER.
14532270 Glup/PACRG suppresses cell death induced by accumulation of unfolded Pael receptor and facilitates the formation of Pael-R inclusions.
12670421 results show that panneuronal expression of Parkin substrate Pael-R causes age-dependent selective degeneration of Drosophila dopaminergic (DA) neurons; coexpression of Parkin degrades Pael-R and suppresses its toxicity

AA Sequence

MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRAR      1 - 70
APREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPT     71 - 140
ALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGW    141 - 210
TIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNL    211 - 280
AVMCIVCHNYYMRSISNSLLANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTF    281 - 350
TLCALCIDRFRAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGRAPAERCI    351 - 420
IKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKACTRGNKRQIQLESQM    421 - 490
NCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFFKSCVTPVLLFCLCKPFSRAF    491 - 560
MECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIRREMSTFASVGTHC                     561 - 613
//

Text Mined References (26)

PMID Year Title
25977097 2015 CASPR2 forms a complex with GPR37 via MUPP1 but not with GPR37(R558Q), an autism spectrum disorder-related mutation.
25169131 2014 A low level of GPR37 is associated with human hepatocellular carcinoma progression and poor patient survival.
24290813 2014 The role of the orphan G protein-coupled receptor 37 (GPR37) in multiple myeloma cells.
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
23690594 2013 GPR37 and GPR37L1 are receptors for the neuroprotective and glioprotective factors prosaptide and prosaposin.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23251443 2012 Mutation in Parkinson disease-associated, G-protein-coupled receptor 37 (GPR37/PaelR) is related to autism spectrum disorder.
21372109 2011 Absence of the GPR37/PAEL receptor impairs striatal Akt and ERK2 phosphorylation, DeltaFosB expression, and conditioned place preference to amphetamine and cocaine.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19799451 2009 GPR37 surface expression enhancement via N-terminal truncation or protein-protein interactions.
19218498 2009 Induction of macroautophagy by overexpression of the Parkinson's disease-associated GPR37 receptor.
18691389 2008 Pael-R transgenic mice crossed with parkin deficient mice displayed progressive and selective catecholaminergic neuronal loss.
17059562 2006 A ubiquitin ligase HRD1 promotes the degradation of Pael receptor, a substrate of Parkin.
16539653 2006 Suppressive effects of 4-phenylbutyrate on the aggregation of Pael receptors and endoplasmic reticulum stress.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14532270 2003 A product of the human gene adjacent to parkin is a component of Lewy bodies and suppresses Pael receptor-induced cell death.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12670421 2003 Parkin suppresses dopaminergic neuron-selective neurotoxicity induced by Pael-R in Drosophila.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12150907 2002 CHIP is associated with Parkin, a gene responsible for familial Parkinson's disease, and enhances its ubiquitin ligase activity.
11439185 2001 An unfolded putative transmembrane polypeptide, which can lead to endoplasmic reticulum stress, is a substrate of Parkin.
9526070 1998 A human gene encodes a putative G protein-coupled receptor highly expressed in the central nervous system.
9339362 1997 Cloning of GPR37, a gene located on chromosome 7 encoding a putative G-protein-coupled peptide receptor, from a human frontal brain EST library.
9144577 1997 A novel endothelin receptor type-B-like gene enriched in the brain.