Property Summary

Ligand Count 1
NCBI Gene PubMed Count 16
PubMed Score 21.95
PubTator Score 15.47

Knowledge Summary

Patent (3,141)

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma -1.833 8.5e-03
Astrocytoma, Pilocytic 2.000 1.4e-06
Atopic dermatitis -1.100 9.5e-03
Breast cancer -1.400 4.1e-07
Duchenne muscular dystrophy 1.214 2.0e-06
ductal carcinoma in situ -1.400 1.8e-03
group 3 medulloblastoma -1.200 2.7e-02
ileal Crohn's disease -1.418 4.3e-02
intraductal papillary-mucinous carcinoma... -1.800 3.0e-02
invasive ductal carcinoma 1.164 2.8e-02
medulloblastoma, large-cell -1.500 1.9e-04
non-small cell lung cancer -1.082 5.2e-06
ovarian cancer -1.900 1.3e-06
pancreatic ductal adenocarcinoma liver m... -1.374 3.6e-03
pituitary cancer 2.400 8.3e-05
primary Sjogren syndrome 1.300 9.2e-03
ulcerative colitis 1.100 6.4e-04

Gene RIF (7)

AA Sequence

MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLV      1 - 70
GNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYI     71 - 140
SIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDK    141 - 210
HNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFV    211 - 280
PYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEP    281 - 350
SRSESTSEFKPGYSLHDTSVAVKIQSSSKST                                           351 - 381
//

Text Mined References (16)

PMID Year Title