Property Summary

NCBI Gene PubMed Count 16
PubMed Score 19.41
PubTator Score 15.47

Knowledge Summary

Patent (3,141)

Expression

  Differential Expression (17)

Disease log2 FC p
medulloblastoma, large-cell -1.500 1.9e-04
Duchenne muscular dystrophy 1.214 2.0e-06
Atopic dermatitis -1.100 9.5e-03
adrenocortical carcinoma -1.833 8.5e-03
pancreatic ductal adenocarcinoma liver m... -1.374 3.6e-03
non-small cell lung cancer -1.082 5.2e-06
intraductal papillary-mucinous carcinoma... -1.800 3.0e-02
group 3 medulloblastoma -1.200 2.7e-02
pilocytic astrocytoma 2.000 1.4e-06
primary Sjogren syndrome 1.300 9.2e-03
invasive ductal carcinoma -1.300 6.5e-03
Breast cancer -1.400 4.1e-07
ductal carcinoma in situ -1.400 1.8e-03
ulcerative colitis 1.100 6.4e-04
ovarian cancer -1.900 1.3e-06
ileal Crohn's disease -1.418 4.3e-02
pituitary cancer 2.400 8.3e-05

Gene RIF (7)

PMID Text
27086875 By monitoring fused FLAG-tag and conformation-sensitive native epitope during expression of GPR34 mutants, a tri-basic motif in the first intracellular loop was identified as key topogenic signal that dictates the orientation of transmembrane domain-1.
25673461 GPR34 knockdown impairs the proliferation and migration of HGC-27 gastric cancer cells in vitro and provides a potential implication for therapy of gastric cancer.
23836308 up-regulation of GPR34 expression in human gastric carcinoma may play a critical role in tumor progression and in determining patient prognosis
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of G protein-coupled receptor 34 (GPR34) in peptide-treated PBMCs
22966169 these results are the first to identify a role for a GPR34 in lymphoma cell growth, provide insight into GPR34-mediated signaling, identify a genetically unique subset of MZLs that express high levels of GPR34.
22343749 The present studies confirm that GPR34 is a cellular receptor for LysoPS, especially with a fatty acid at the sn-2 position.
16338117 data show that multiple translation initiation starts and alternative splicing contribute to the supragenomic diversification of GPR34

AA Sequence

MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLV      1 - 70
GNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYI     71 - 140
SIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDK    141 - 210
HNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFV    211 - 280
PYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEP    281 - 350
SRSESTSEFKPGYSLHDTSVAVKIQSSSKST                                           351 - 381
//

Text Mined References (16)

PMID Year Title
27086875 2016 Topogenesis and cell surface trafficking of GPR34 are facilitated by positive-inside rule that effects through a tri-basic motif in the first intracellular loop.
25673461 2015 G-protein coupled receptor 34 knockdown impairs the proliferation and migration of HGC-27 gastric cancer cells in vitro.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
23836308 2013 Upregulation of GPR34 expression affects the progression and prognosis of human gastric adenocarcinoma by PI3K/PDK1/AKT pathway.
22966169 2012 t(X;14)(p11;q32) in MALT lymphoma involving GPR34 reveals a role for GPR34 in tumor cell growth.
22343749 2012 GPR34 is a receptor for lysophosphatidylserine with a fatty acid at the sn-2 position.
16341674 2005 Transcriptome analysis of human gastric cancer.
16338117 2006 Genomic and supragenomic structure of the nucleotide-like G-protein-coupled receptor GPR34.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10982042 2000 Physical mapping and exclusion of GPR34 as the causative gene for congenital stationary night blindness type 1.
10395919 1999 A novel subgroup of class I G-protein-coupled receptors.
10036181 1999 Discovery of three novel orphan G-protein-coupled receptors.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.