Property Summary

Ligand Count 1
NCBI Gene PubMed Count 16
PubMed Score 37.51
PubTator Score 62.74

Knowledge Summary

Patent (7,986)

Expression

Gene RIF (8)

AA Sequence

MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPA      1 - 70
FRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYN     71 - 140
ALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIML    141 - 210
QLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTY    211 - 280
LTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV                        281 - 330
//

Text Mined References (19)

PMID Year Title