Property Summary

NCBI Gene PubMed Count 15
PubMed Score 36.06
PubTator Score 62.74

Knowledge Summary

Patent (7,986)

TINX Plot

Expression

Gene RIF (7)

PMID Text
24069330 Gpr3 stimulates Abeta production via interactions with APP and beta-arrestin2.
23732663 GPR3 is a key factor in the regulation of the nervous system and follicle development.[review]
20158988 Mutations in GPR3 are not a common cause of premature ovarian failure in Chinese women.
17953967 We conclude that perturbations in GPR3 are not a common explanation for POF in this population.
17953967 Observational study of genotype prevalence. (HuGE Navigator)
15591206 GPR3 is expressed in the ovary and testes, and is necessary for the regulation of meiosis in mouse.
12649592 control of gene expression in vascular endothelial cells in the presence of fluid shear stress and classifies it as a sphingosine 1-phosphate receptor.

AA Sequence

MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPA      1 - 70
FRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYN     71 - 140
ALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIML    141 - 210
QLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTY    211 - 280
LTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV                        281 - 330
//

Text Mined References (18)

PMID Year Title
24069330 2013 Gpr3 stimulates A? production via interactions with APP and ?-arrestin2.
23732663 2013 [G protein-coupled receptor 3: a key factor in the regulation of the nervous system and follicle development].
20158988 2010 GPR3 may not be a potential candidate gene for premature ovarian failure.
19286662 2009 Lipid G protein-coupled receptor ligand identification using beta-arrestin PathHunter assay.
19213921 2009 The orphan G protein-coupled receptor 3 modulates amyloid-beta peptide generation in neurons.
17953967 2008 Oocyte-specific G-protein-coupled receptor 3 (GPR3): no perturbations found in 82 women with premature ovarian failure (first report).
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15591206 2004 The Gs-linked receptor GPR3 maintains meiotic arrest in mammalian oocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12649592 2003 Fluid shear stress differentially regulates gpr3, gpr6, and gpr12 expression in human umbilical vein endothelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220620 2002 Sphingosine 1-phosphate is a ligand of the human gpr3, gpr6 and gpr12 family of constitutively active G protein-coupled receptors.
8530049 1995 Molecular cloning and chromosomal localization of human genes encoding three closely related G protein-coupled receptors.
7851889 1994 Cloning of human genes encoding novel G protein-coupled receptors.
7832990 1995 Isolation of three novel human genes encoding G protein-coupled receptors.
7698767 1994 Isolation and chromosomal localization of a novel human G-protein-coupled receptor (GPR3) expressed predominantly in the central nervous system.
7639700 1995 Molecular cloning of an orphan G-protein-coupled receptor that constitutively activates adenylate cyclase.