Property Summary

NCBI Gene PubMed Count 1
PubMed Score 2.58
PubTator Score 2.56

Knowledge Summary

Patent (2,425)

AA Sequence

MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLLLDLCLADGLRALA      1 - 70
CLPAVMLAARRAAAAAGAPPGALGCKLLAFLAALFCFHAAFLLLGVGVTRYLAIAHHRFYAERLAGWPCA     71 - 140
AMLVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAVVVGATHLVYLRLLFFIHD    141 - 210
RRKMRPARLVPAVSHDWTFHGPGATGQAAANWTAGFGRGPTPPALVGIRPAGPGRGARRLLVLEEFKTEK    211 - 280
RLCKMFYAVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVVCFLFNRELRDCFR    281 - 350
AQFPCCQSPRTTQATHPCDLKGIGL                                                 351 - 375
//

Text Mined References (1)

PMID Year Title
10833454 2000 An evolutionarily conserved G-protein coupled receptor family, SREB, expressed in the central nervous system.