Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.04
PubTator Score 6.61

Knowledge Summary

Patent (2,717)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.000 2.1e-03
ependymoma -4.500 3.4e-19
oligodendroglioma -1.700 1.6e-02
glioblastoma -4.800 8.6e-06
medulloblastoma -4.800 2.0e-08
atypical teratoid / rhabdoid tumor -4.900 5.1e-10
medulloblastoma, large-cell -3.900 8.0e-03
primitive neuroectodermal tumor -4.700 7.7e-05
diabetes mellitus 1.100 1.1e-03
adult high grade glioma -4.500 8.4e-05
pilocytic astrocytoma -4.600 2.2e-08
lung carcinoma 1.600 3.8e-12
ovarian cancer -1.100 4.7e-06

Synonym

Accession Q8NDV2 Q2M2E2
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (3)

Bryan Roth 313 functional assay
Jing-Ruey Yeh 64 gRNA validated for zebrafish model
Steve Finkbeiner 41 Neuron specific phenotypes being screened

Gene RIF (4)

PMID Text
26303144 GPR26 may have a common role in the formation or degradation of intranuclear inclusions in several neurodegenerative diseases
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19787267 epigenetic silencing is a common mechanism in malignant gliomas that simultaneously inactivates MGMT and GPR26
18037267 Study has identified GPR26 to be a genetic indicator of primary glioblastoma, suggesting that it could be a suppressor of primary glioblastoma development.

AA Sequence

MNSWDAGLAGLLVGTMGVSLLSNALVLLCLLHSADIRRQAPALFTLNLTCGNLLCTVVNMPLTLAGVVAQ      1 - 70
RQPAGDRLCRLAAFLDTFLAANSMLSMAALSIDRWVAVVFPLSYRAKMRLRDAALMVAYTWLHALTFPAA     71 - 140
ALALSWLGFHQLYASCTLCSRRPDERLRFAVFTGAFHALSFLLSFVVLCCTYLKVLKVARFHCKRIDVIT    141 - 210
MQTLVLLVDLHPSVRERCLEEQKRRRQRATKKISTFIGTFLVCFAPYVITRLVELFSTVPIGSHWGVLSK    211 - 280
CLAYSKAASDPFVYSLLRHQYRKSCKEILNRLLHRRSIHSSGLTGDSHSQNILPVSE                 281 - 337
//

Text Mined References (13)

PMID Year Title
26303144 2016 G protein-coupled receptor 26 immunoreactivity in intranuclear inclusions associated with polyglutamine and intranuclear inclusion body diseases.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19787267 2009 The 10q25.3-26.1 G protein-coupled receptor gene GPR26 is epigenetically silenced in human gliomas.
18037267 2008 GPR26: a marker for primary glioblastoma?
17363172 2007 Tissue distribution and functional analyses of the constitutively active orphan G protein coupled receptors, GPR26 and GPR78.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854302 2002 Oligomerization of G-protein-coupled receptors shown by selective co-immunoprecipitation.
10684976 2000 Cloning and characterization of additional members of the G protein-coupled receptor family.
8401585 1993 Rapid cDNA sequencing (expressed sequence tags) from a directionally cloned human infant brain cDNA library.