Property Summary

NCBI Gene PubMed Count 12
PubMed Score 34.27
PubTator Score 16.14

Knowledge Summary

Patent (2,017)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Dental fluorosis 18 3.121 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 2.200 3.0e-03
ductal carcinoma in situ 1.500 4.2e-02
interstitial cystitis 2.600 4.2e-03
malignant mesothelioma 1.300 3.4e-05
osteosarcoma -3.382 1.0e-06
primary Sjogren syndrome 2.700 7.1e-05
psoriasis -1.900 4.1e-04
sarcoidosis 1.100 1.2e-02
ulcerative colitis 1.600 2.6e-02

Gene RIF (5)

AA Sequence

MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIYMMNVALVDLI      1 - 70
FIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRYMAIVQPKYAKELKNTCKAVL     71 - 140
ACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLTFFFLIPLFIMIGCYLVI    141 - 210
IHNLLHGRTSKLKPKVKEKSIRIIITLLVQVLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTC    211 - 280
LDVILYYIVSKQFQARVISVMLYRNYLRSMRRKSFRSGSLRSLSNINSEML                       281 - 331
//

Text Mined References (14)

PMID Year Title