Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.69
PubTator Score 2.15

Knowledge Summary

Patent (266)

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 6.5e-04
glioblastoma 1.100 4.0e-04
medulloblastoma 1.300 3.3e-03
medulloblastoma, large-cell 1.500 4.5e-05
oligodendroglioma 1.400 1.7e-02
osteosarcoma 1.221 4.5e-04
primitive neuroectodermal tumor 1.200 1.7e-04

Gene RIF (1)

AA Sequence

MANTTGEPEEVSGALSPPSASAYVKLVLLGLIMCVSLAGNAILSLLVLKERALHKAPYYFLLDLCLADGI      1 - 70
RSAVCFPFVLASVRHGSSWTFSALSCKIVAFMAVLFCFHAAFMLFCISVTRYMAIAHHRFYAKRMTLWTC     71 - 140
AAVICMAWTLSVAMAFPPVFDVGTYKFIREEDQCIFEHRYFKANDTLGFMLMLAVLMAATHAVYGKLLLF    141 - 210
EYRHRKMKPVQMVPAISQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNGHAASRRLLGMDEVKG    211 - 280
EKQLGRMFYAITLLFLLLWSPYIVACYWRVFVKACAVPHRYLATAVWMSFAQAAVNPIVCFLLNKDLKKC    281 - 350
LRTHAPCWGTGGAPAPREPYCVM                                                   351 - 373
//

Text Mined References (8)

PMID Year Title