Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.11
PubTator Score 0.80

Knowledge Summary

Patent (1,931)

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.100 2.9e-02
cutaneous lupus erythematosus 2.700 5.9e-04
osteosarcoma -2.412 3.0e-03
Atopic dermatitis 1.500 1.6e-03
tuberculosis and treatment for 6 months -2.200 5.5e-04
non-small cell lung cancer -1.192 7.4e-07
intraductal papillary-mucinous neoplasm ... -1.300 4.9e-02
lung cancer -3.000 1.1e-04
interstitial cystitis 2.400 8.3e-04
primary Sjogren syndrome 1.400 2.4e-03
lung carcinoma -1.400 5.1e-07
acute myeloid leukemia -1.200 2.9e-02
ovarian cancer -1.800 1.2e-03
psoriasis 1.300 2.6e-23

AA Sequence

MTNSSFFCPVYKDLEPFTYFFYLVFLVGIIGSCFATWAFIQKNTNHRCVSIYLINLLTADFLLTLALPVK      1 - 70
IVVDLGVAPWKLKIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLTHSCKIYRIQEPGFAKMISTVVWL     71 - 140
MVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLTNFICVAIFLNFSAIILISNCLVIRQLYRNK    141 - 210
DNENYPNVKKALINILLVTTGYIICFVPYHIVRIPYTLSQTEVITDCSTRISLFKAKEATLLLAVSNLCF    211 - 280
DPILYYHLSKAFRSKVTETFASPKETKAQKEKLRCENNA                                   281 - 319
//

Text Mined References (7)

PMID Year Title
24043826 2013 GPR171 is a hypothalamic G protein-coupled receptor for BigLEN, a neuropeptide involved in feeding.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11524702 2001 Mutations in a novel gene with transmembrane domains underlie Usher syndrome type 3.
9370294 1997 A genetic selection for isolating cDNAs encoding secreted proteins.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.