Property Summary

Ligand Count 13
NCBI Gene PubMed Count 23
PubMed Score 156.08
PubTator Score 82.05

Knowledge Summary

Patent (28,770)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Brain infarction 22 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Suppression amblyopia 8 3.516 1.8
Periventricular leukomalacia 7 3.375 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic 4.100 6.7e-07
atypical teratoid / rhabdoid tumor -2.600 3.3e-06
glioblastoma multiforme -1.200 7.0e-04
group 3 medulloblastoma -1.600 3.3e-02
medulloblastoma, large-cell -2.700 2.2e-04
psoriasis -1.200 3.9e-25

Gene RIF (15)

AA Sequence

MSKRSWWAGSRKPPREMLKLSGSDSSQSMNGLEVAPPGLITNFSLATAEQCGQETPLENMLFASFYLLDF      1 - 70
ILALVGNTLALWLFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIACRLTGFLFY     71 - 140
LNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWVVVAVAMAPLLVSPQTVQTNHTVVCL    141 - 210
QLYREKASHHALVSLAVAFTFPFITTVTCYLLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYH    211 - 280
VNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPP    281 - 350
SFEGKTNESSLSAKSEL                                                         351 - 367
//

Text Mined References (24)

PMID Year Title