Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.04
PubTator Score 3.26

Knowledge Summary

Patent (620)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.500 1.0e-02
glioblastoma -2.700 7.5e-05
posterior fossa group A ependymoma -3.100 2.4e-12
sonic hedgehog group medulloblastoma -3.500 9.1e-08
atypical teratoid / rhabdoid tumor -4.000 1.0e-06
medulloblastoma, large-cell -2.900 5.7e-04
primitive neuroectodermal tumor -3.600 9.0e-05
adult high grade glioma -2.500 8.6e-07
subependymal giant cell astrocytoma -2.352 3.6e-02
lung carcinoma 1.200 4.7e-08
Pick disease -1.900 2.5e-02
ovarian cancer 1.600 3.8e-06
pituitary cancer -1.200 6.9e-04
psoriasis 2.600 1.2e-46
facioscapulohumeral dystrophy 2.100 2.3e-02

Gene RIF (5)

PMID Text
25693195 expression and functional role of orphan receptor GPR158 in prostate cancer growth and progression
23451275 Mutation of the NLS abrogates GPR158-mediated enhancement of cell proliferation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGAMAYPLLLCLLLAQLGLGAVGASRDPQGRPDSPRERTPKGKPHAQQPGRASASDSSAPWSRSTDGTIL      1 - 70
AQKLAEEVPMDVASYLYTGDSHQLKRANCSGRYELAGLPGKWPALASAHPSLHRALDTLTHATNFLNVML     71 - 140
QSNKSREQNLQDDLDWYQALVWSLLEGEPSISRAAITFSTDSLSAPAPQVFLQATREESRILLQDLSSSA    141 - 210
PHLANATLETEWFHGLRRKWRPHLHRRGPNQGPRGLGHSWRRKDGLGGDKSHFKWSPPYLECENGSYKPG    211 - 280
WLVTLSSAIYGLQPNLVPEFRGVMKVDINLQKVDIDQCSSDGWFSGTHKCHLNNSECMPIKGLGFVLGAY    281 - 350
ECICKAGFYHPGVLPVNNFRRRGPDQHISGSTKDVSEEAYVCLPCREGCPFCADDSPCFVQEDKYLRLAI    351 - 420
ISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFRCILLRWARLL    421 - 490
GFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVILLVVFWFLIGWTSSVCQNLEKQISLIG    491 - 560
QGKTSDHLIFNMCLIDRWDYMTAVAEFLFLLWGVYLCYAVRTVPSAFHEPRYMAVAVHNELIISAIFHTI    561 - 630
RFVLASRLQSDWMLMLYFAHTHLTVTVTIGLLLIPKFSHSSNNPRDDIATEAYEDELDMGRSGSYLNSSI    631 - 700
NSAWSEHSLDPEDIRDELKKLYAQLEIYKRKKMITNNPHLQKKRCSKKGLGRSIMRRITEIPETVSRQCS    701 - 770
KEDKEGADHGTAKGTALIRKNPPESSGNTGKSKEETLKNRVFSLKKSHSTYDHVRDQTEESSSLPTESQE    771 - 840
EETTENSTLESLSGKKLTQKLKEDSEAESTESVPLVCKSASAHNLSSEKKTGHPRTSMLQKSLSVIASAK    841 - 910
EKTLGLAGKTQTAGVEERTKSQKPLPKDKETNRNHSNSDNTETKDPAPQNSNPAEEPRKPQKSGIMKQQR    911 - 980
VNPTTANSDLNPGTTQMKDNFDIGEVCPWEVYDLTPGPVPSESKVQKHVSIVASEMEKNPTFSLKEKSHH    981 - 1050
KPKAAEVCQQSNQKRIDKAEVCLWESQGQSILEDEKLLISKTPVLPERAKEENGGQPRAANVCAGQSEEL   1051 - 1120
PPKAVASKTENENLNQIGHQEKKTSSSEENVRGSYNSSNNFQQPLTSRAEVCPWEFETPAQPNAGRSVAL   1121 - 1190
PASSALSANKIAGPRKEEIWDSFKV                                                1191 - 1215
//

Text Mined References (15)

PMID Year Title
25792749 2015 Orphan Receptor GPR158 Is an Allosteric Modulator of RGS7 Catalytic Activity with an Essential Role in Dictating Its Expression and Localization in the Brain.
25693195 2015 Expression and functional role of orphan receptor GPR158 in prostate cancer growth and progression.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23451275 2013 GPR158, an orphan member of G protein-coupled receptor Family C: glucocorticoid-stimulated expression and novel nuclear role.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18655026 2008 Proteomic analysis of ubiquitinated proteins in normal hepatocyte cell line Chang liver cells.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16229975 2005 The gene repertoire and the common evolutionary history of glutamate, pheromone (V2R), taste(1) and other related G protein-coupled receptors.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.