1. Home
  2. Targets
  3. GPCR
  4. Class A rhodopsin like
  5. G-protein coupled receptor 15

Tbio G-protein coupled receptor 15

Probable chemokine receptor. Alternative coreceptor with CD4 for HIV-1 infection.

This gene encodes a G protein-coupled receptor that acts as a chemokine receptor for human immunodeficiency virus type 1 and 2. The encoded protein localizes to the cell membrane. [provided by RefSeq, Nov 2012]

 Comments

Property Summary

NCBI Gene PubMed Count 17
PubMed Score 213.45
PubTator Score 516.98

Knowledge Summary

Patent (18,128)

TINX Plot

  Disease (3)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
psoriasis 6685 6.5e-17
lung adenocarcinoma 2714 4.2e-07
osteosarcoma 7933 2.7e-05
diabetes mellitus 1663 1.1e-03

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.138 2.7e-05
diabetes mellitus 1.100 1.1e-03
lung adenocarcinoma 1.600 4.2e-07
psoriasis 1.900 6.5e-17

Synonym

Accession P49685 Q3MIL4 Q6ISN6
Symbols BOB

Gene

GPR15

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

  TechDev Info (1)

Bryan Roth 313 functional assay

 Collection (1)

 UniProt Keyword (10)

 GO Function (1)

 GO Component (2)

 GO Process (2)

 Compartment GO Term (13)

 IMPC Phenotype (1)

 MGI Phenotype (5)

 HCA RNA Cell Line (19)

See all...

Pathway (5)

Protein-protein Interaction (67)

GPR25   RAMP1   RAMP2   RAMP3   GPR32   AVP   TSHB   LHB   CALCA   PTH   VIP   GHRH   RLN2   CALCA   SCT   NPS   IAPP   PTHLH   TSHR   ADCYAP1   LHCGR   HRH2   AVPR2   VIPR1   MC4R   MC5R   PTGER4   ADCYAP1R1   VIPR2   MC3R   PTGER2   PTGIR   GLP1R   SCTR   PIK3CG   PTH2R   INSL3   UCN   GNG2   PLCB2   MC1R   PLCB3   GHRHR   PTH1R   PTGDR   CRHR2   GPR176   PIK3R6   NPSR1   ADM2   GPHB5   GPR150   GPBAR1   RXFP2   RLN3   PIK3R5   PTH2   P2RY11   TAAR1   GPHA2   GPR20   RXFP1   PLCB1   GPR84   GPR27   GPR83   GPR45  

Gene RIF (13)

PMID Text
26348578 Analysis of GPR15 methylation identified significantly greater hypomethylation in smokers compared with that in never-smokers.
24897520 HIV-1 ZP6248 T/F virus efficiently uses an alternative coreceptor GPR15 to establish clinical infection, and gp120 G306A, V307A, E314A, K315A, V316A, Y317A, F318A and S322A mutations significantly reduce or abolish the replication capacity in GPR15+ cells
24725539 Data indicate that orphan receptor GPR15/BOB is expressed by macrophages in synovial tissue and on monocytes and neutrophils in peripheral blood, and expression is up-regulated in arthritis (RA)patients
24558379 infection-induced up-regulation of GPR15 expression through TLR3 could increase susceptibility of CD4(+) T cells to HIV infection and target cell availability in the gut in some infected individuals
23661644 GPR15 expression was minimal in lymphocytes from the blood and the small intestine; however, it was expressed at high levels in lymphocytes from the large intestine
23430259 C-terminal membrane-proximal basic residues have a role in cell surface trafficking of HIV coreceptor GPR15 protein
22086059 HIV-1 ZP6248 T/F virus efficiently uses an alternative coreceptor GPR15 to establish clinical infection, and gp120 G306A, V307A, E314A, K315A, V316A, Y317A, F318A and S322A mutations significantly reduce or abolish the replication capacity in GPR15+ cells
21835785 HIV-1 ZP6248 T/F virus efficiently uses an alternative coreceptor GPR15 to establish clinical infection, and gp120 G306A, V307A, E314A, K315A, V316A, Y317A, F318A and S322A mutations significantly reduce or abolish the replication capacity in GPR15+ cells
21189250 14-3-3 proteins play multiple roles in biogenesis and trafficking of an HIV co-receptor GPR15 to control its cell surface density in response to the phosphorylation signal
15992849 HIV-1 ZP6248 T/F virus efficiently uses an alternative coreceptor GPR15 to establish clinical infection, and gp120 G306A, V307A, E314A, K315A, V316A, Y317A, F318A and S322A mutations significantly reduce or abolish the replication capacity in GPR15+ cells
15650194 HIV-2 isolates from aviremic and viremic individuals commonly use as coreceptors CCR5, GPR15, and CXCR6
12566994 role of GPR15-HIV1 gp120 interactions in gp120 binding to intestinal epithelial cells and gp120-induced cytopathic effects
11696454 HIV-1 ZP6248 T/F virus efficiently uses an alternative coreceptor GPR15 to establish clinical infection, and gp120 G306A, V307A, E314A, K315A, V316A, Y317A, F318A and S322A mutations significantly reduce or abolish the replication capacity in GPR15+ cells

AA Sequence 

MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDI      1 - 70
FIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVV     71 - 140
SRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLS    141 - 210
IVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAIL    211 - 280
QLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDF    281 - 350
ARRRKRSVSL                                                                351 - 360
//

Text Mined References (17)

PMID Year Title
26348578 2015 Smoking-induced expression of the GPR15 gene indicates its potential role in chronic inflammatory pathologies.
24725539 2014 Orphan receptor GPR15/BOB is up-regulated in rheumatoid arthritis.
24558379 2014 Toll-like receptor 3 signalling up-regulates expression of the HIV co-receptor G-protein coupled receptor 15 on human CD4+ T cells.
23661644 2013 GPR15-mediated homing controls immune homeostasis in the large intestine mucosa.
23430259 2013 Role of C-terminal membrane-proximal basic residues in cell surface trafficking of HIV coreceptor GPR15 protein.
21189250 2011 Phosphorylation-dependent C-terminal binding of 14-3-3 proteins promotes cell surface expression of HIV co-receptor GPR15.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15650194 2005 CCR5, GPR15, and CXCR6 are major coreceptors of human immunodeficiency virus type 2 variants isolated from individuals with and without plasma viremia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12566994 The virotoxin model of HIV-1 enteropathy: involvement of GPR15/Bob and galactosylceramide in the cytopathic effects induced by HIV-1 gp120 in the HT-29-D4 intestinal cell line.
12555203 2003 Expression of chemokines and their receptors in human and simian astrocytes: evidence for a central role of TNF alpha and IFN gamma in CXCR4 and CCR5 modulation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11696454 2001 Gp120-induced Bob/GPR15 activation: a possible cause of human immunodeficiency virus enteropathy.
10985245 2000 The level of HIV infection of macrophages is determined by interaction of viral and host cell genotypes.
9236192 1997 Two orphan seven-transmembrane segment receptors which are expressed in CD4-positive cells support simian immunodeficiency virus infection.
9230441 1997 Expression cloning of new receptors used by simian and human immunodeficiency viruses.
8838812 1996 A novel human gene encoding a G-protein-coupled receptor (GPR15) is located on chromosome 3.