Property Summary

NCBI Gene PubMed Count 7
PubMed Score 149.14
PubTator Score 32.13

Knowledge Summary

Patent (9,561)

TINX Plot

Gene RIF (1)

AA Sequence

MGDELAPCPVGTTAWPALIQLISKTPCMPQAASNTSLGLGDLRVPSSMLYWLFLPSSLLAAATLAVSPLL      1 - 70
LVTILRNQRLRQEPHYLLPANILLSDLAYILLHMLISSSSLGGWELGRMACGILTDAVFAACTSTILSFT     71 - 140
AIVLHTYLAVIHPLRYLSFMSHGAAWKAVALIWLVACCFPTFLIWLSKWQDAQLEEQGASYILPPSMGTQ    141 - 210
PGCGLLVIVTYTSILCVLFLCTALIANCFWRIYAEAKTSGIWGQGYSRARGTLLIHSVLITLYVSTGVVF    211 - 280
SLDMVLTRYHHIDSGTHTWLLAANSEVLMMLPRAMLTYLYLLRYRQLLGMVRGHLPSRRHQAIFTIS       281 - 347
//

Text Mined References (8)

PMID Year Title