Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 3.6e-02
glioblastoma -1.600 2.1e-03
posterior fossa group B ependymoma -2.100 5.8e-07
atypical teratoid / rhabdoid tumor -1.400 6.9e-03
medulloblastoma, large-cell -1.300 2.6e-03
adult high grade glioma -1.400 1.1e-02
group 4 medulloblastoma 1.300 1.9e-02
pilocytic astrocytoma -1.400 6.8e-04
subependymal giant cell astrocytoma -1.779 3.4e-02
Pick disease -1.100 6.8e-03
Breast cancer 1.100 2.3e-05

Synonym

Accession Q8N3F9 Q86SM2
Symbols TM7SF1L2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MRVSVPGPAAAAAPAAGREPSTPGGGSGGGGAVAAASGAAVPGSVQLALSVLHALLYAALFAFAYLQLWR      1 - 70
LLLYRERRLSYQSLCLFLCLLWAALRTTLFSAAFSLSGSLPLLRPPAHLHFFPHWLLYCFPSCLQFSTLC     71 - 140
LLNLYLAEVICKVRCATELDRHKILLHLGFIMASLLFLVVNLTCAMLVHGDVPENQLKWTVFVRALINDS    141 - 210
LFILCAISLVCYICKITKMSSANVYLESKGMSLCQTVVVGSVVILLYSSRACYNLVVVTISQDTLESPFN    211 - 280
YGWDNLSDKAHVEDISGEEYIVFGMVLFLWEHVPAWSVVLFFRAQRLNQNLAPAGMINSHSYSSRAYFFD    281 - 350
NPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAPLLFTCSNLDLNNH    351 - 420
HSLYVTPQN                                                                 421 - 429
//

Text Mined References (5)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16341674 2005 Transcriptome analysis of human gastric cancer.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12508121 2003 The DNA sequence and analysis of human chromosome 14.