Property Summary

NCBI Gene PubMed Count 20
PubMed Score 482.02
PubTator Score 48.10

Knowledge Summary

Patent (14,636)

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1563 6.4e-07
invasive ductal carcinoma 2950 1.8e-03
Disease Target Count Z-score Confidence
Leishmaniasis 49 3.439 1.7
Cancer 2346 3.381 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis -2.600 6.4e-07
invasive ductal carcinoma 1.408 1.8e-03

Gene RIF (13)

PMID Text
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19855098 we found an additional novel G2A variant (G2A-b) that is the major transcript with functional response to ligand stimulation as well as G2A-a, and succeeded in discriminating proton-sensing and oxidized fatty acid-sensing activities of G2A.
18174230 Observational study of gene-disease association. (HuGE Navigator)
18089568 the G-protein-coupled receptor G2A, unlike its relative GPR4, is involved in the chemotaxis of monocytic cells.
18034171 9-HODE-G2A signaling plays proinflammatory roles in skin under oxidative conditions
17475884 G2A latent within neutrophil secretory vesicles may facilitate signaling through lysophospholipids for neutrophil activation and calcium flux.
16236715 results indicate that G protein-coupled receptor G2A is a receptor for 9-hydroxyoctadecadienoic acid (9-HODE) and other oxidized free fatty acids and is activated by oxidized free fatty acids
15665078 Activity of the human G2A receptor is less sensitive to pH fluctuations as measured by inositol phosphate and cAMP accumulation.
15280385 G2A is a proton-sensing G-protein-coupled receptor antagonized by lysophosphatidylcholine
12805023 G2A was not detected in either brain or skin vascular endothelial cell type.
12586833 G2A can activate a specific combination of G proteins, and G2A/LPC-induced apoptosis involves both G alpha(13)- and G alpha(s)-mediated pathways
12482833 In atherosclerotic plaques of human coronary arterial specimens, G2A is expressed by macrophages within the lipid-rich plaques, whereas no immunoreactivity of G2A is observed in fibrous plaques where macrophages do not exist.
12086852 G2A is a negative modifier of lymphoid leukemogenesis initiated by the BCR-ABL oncogene

AA Sequence

MCPMLLKNGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRIVLVVVYSAVCTLGVPANCLTAWLALLQ      1 - 70
VLQGNVLAVYLLCLALCELLYTGTLPLWVIYIRNQHRWTLGLLACKVTAYIFFCNIYVSILFLCCISCDR     71 - 140
FVAVVYALESRGRRRRRTAILISACIFILVGIVHYPVFQTEDKETCFDMLQMDSRIAGYYYARFTVGFAI    141 - 210
PLSIIAFTNHRIFRSIKQSMGLSAAQKAKVKHSAIAVVVIFLVCFAPYHLVLLVKAAAFSYYRGDRNAMC    211 - 280
GLEERLYTASVVFLCLSTVNGVADPIIYVLATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSP    281 - 350
VALADHYTFSRPVHPPGSPCPAKRLIEESC                                            351 - 380
//

Text Mined References (24)

PMID Year Title
22621271 2012 Therapeutic options for transfusion related acute lung injury; the potential of the G2A receptor.
20799926 2010 Lysophosphatidylcholines activate G2A inducing G(?i)??-/G(?q/)??- Ca²(+) flux, G(??)-Hck activation and clathrin/?-arrestin-1/GRK6 recruitment in PMNs.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19855098 2010 Identification and analysis of two splice variants of human G2A generated by alternative splicing.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18089568 2008 Migration to apoptotic "find-me" signals is mediated via the phagocyte receptor G2A.
18034171 2008 G2A plays proinflammatory roles in human keratinocytes under oxidative stress as a receptor for 9-hydroxyoctadecadienoic acid.
17475884 2007 Lysophospholipids of different classes mobilize neutrophil secretory vesicles and induce redundant signaling through G2A.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236715 2005 Identification of 9-hydroxyoctadecadienoic acid and other oxidized free fatty acids as ligands of the G protein-coupled receptor G2A.
15665078 2005 Differential proton sensitivity of related G protein-coupled receptors T cell death-associated gene 8 and G2A expressed in immune cells.
15653487 2005 Retraction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280385 2004 G2A is a proton-sensing G-protein-coupled receptor antagonized by lysophosphatidylcholine.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12805023 2003 Inflammatory stress increases receptor for lysophosphatidylcholine in human microvascular endothelial cells.
12586833 2003 The lysophospholipid receptor G2A activates a specific combination of G proteins and promotes apoptosis.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12482833 2002 Expression of G2A, a receptor for lysophosphatidylcholine, by macrophages in murine, rabbit, and human atherosclerotic plaques.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12086852 2002 Positron emission tomography imaging analysis of G2A as a negative modifier of lymphoid leukemogenesis initiated by the BCR-ABL oncogene.
11474113 2001 Lysophosphatidylcholine as a ligand for the immunoregulatory receptor G2A.
9770487 1998 A DNA damage and stress inducible G protein-coupled receptor blocks cells in G2/M.