| Tchem | Probable G-protein coupled receptor 132 |
May be a receptor for oxidized free fatty acids derived from linoleic and arachidonic acids such as 9-hydroxyoctadecadienoic acid (9-HODE). Activates a G alpha protein, most likely G alpha(q). May be involved in apoptosis. Functions at the G2/M checkpoint to delay mitosis. May function as a sensor that monitors the oxidative states and mediates appropriate cellular responses such as secretion of paracrine signals and attenuation of proliferation. May mediate ths accumulation of intracellular inositol phosphates at acidic pH through proton-sensing activity.
This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pathways. This protein was reported to be a receptor for lysophosphatidylcholine action, but PubMedID: 15653487 retracts this finding and instead suggests this protein to be an effector of lysophosphatidylcholine action. This protein may have proton-sensing activity and may be a receptor for oxidized free fatty acids. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pathways. This protein was reported to be a receptor for lysophosphatidylcholine action, but PubMedID: 15653487 retracts this finding and instead suggests this protein to be an effector of lysophosphatidylcholine action. This protein may have proton-sensing activity and may be a receptor for oxidized free fatty acids. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| tuberculosis | 1563 | 6.4e-07 |
| invasive ductal carcinoma | 2950 | 1.8e-03 |
| Disease | log2 FC | p |
|---|---|---|
| tuberculosis | -2.600 | 6.4e-07 |
| invasive ductal carcinoma | 1.408 | 1.8e-03 |
| PMID | Text | |
|---|---|---|
| 19948975 | Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator) | |
| 19855098 | we found an additional novel G2A variant (G2A-b) that is the major transcript with functional response to ligand stimulation as well as G2A-a, and succeeded in discriminating proton-sensing and oxidized fatty acid-sensing activities of G2A. | |
| 18174230 | Observational study of gene-disease association. (HuGE Navigator) | |
| 18089568 | the G-protein-coupled receptor G2A, unlike its relative GPR4, is involved in the chemotaxis of monocytic cells. | |
| 18034171 | 9-HODE-G2A signaling plays proinflammatory roles in skin under oxidative conditions | |
| 17475884 | G2A latent within neutrophil secretory vesicles may facilitate signaling through lysophospholipids for neutrophil activation and calcium flux. | |
| 16236715 | results indicate that G protein-coupled receptor G2A is a receptor for 9-hydroxyoctadecadienoic acid (9-HODE) and other oxidized free fatty acids and is activated by oxidized free fatty acids | |
| 15665078 | Activity of the human G2A receptor is less sensitive to pH fluctuations as measured by inositol phosphate and cAMP accumulation. | |
| 15280385 | G2A is a proton-sensing G-protein-coupled receptor antagonized by lysophosphatidylcholine | |
| 12805023 | G2A was not detected in either brain or skin vascular endothelial cell type. | |
| 12586833 | G2A can activate a specific combination of G proteins, and G2A/LPC-induced apoptosis involves both G alpha(13)- and G alpha(s)-mediated pathways | |
| 12482833 | In atherosclerotic plaques of human coronary arterial specimens, G2A is expressed by macrophages within the lipid-rich plaques, whereas no immunoreactivity of G2A is observed in fibrous plaques where macrophages do not exist. | |
| 12086852 | G2A is a negative modifier of lymphoid leukemogenesis initiated by the BCR-ABL oncogene |
MCPMLLKNGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRIVLVVVYSAVCTLGVPANCLTAWLALLQ 1 - 70 VLQGNVLAVYLLCLALCELLYTGTLPLWVIYIRNQHRWTLGLLACKVTAYIFFCNIYVSILFLCCISCDR 71 - 140 FVAVVYALESRGRRRRRTAILISACIFILVGIVHYPVFQTEDKETCFDMLQMDSRIAGYYYARFTVGFAI 141 - 210 PLSIIAFTNHRIFRSIKQSMGLSAAQKAKVKHSAIAVVVIFLVCFAPYHLVLLVKAAAFSYYRGDRNAMC 211 - 280 GLEERLYTASVVFLCLSTVNGVADPIIYVLATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSP 281 - 350 VALADHYTFSRPVHPPGSPCPAKRLIEESC 351 - 380 //
| PMID | Year | Title | |
|---|---|---|---|
| 22621271 | 2012 | Therapeutic options for transfusion related acute lung injury; the potential of the G2A receptor. | |
| 20799926 | 2010 | Lysophosphatidylcholines activate G2A inducing G(?i)??-/G(?q/)??- Ca²(+) flux, G(??)-Hck activation and clathrin/?-arrestin-1/GRK6 recruitment in PMNs. | |
| 19948975 | 2009 | Integrative predictive model of coronary artery calcification in atherosclerosis. | |
| 19855098 | 2010 | Identification and analysis of two splice variants of human G2A generated by alternative splicing. | |
| 18174230 | 2008 | Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus. | |
| 18089568 | 2008 | Migration to apoptotic "find-me" signals is mediated via the phagocyte receptor G2A. | |
| 18034171 | 2008 | G2A plays proinflammatory roles in human keratinocytes under oxidative stress as a receptor for 9-hydroxyoctadecadienoic acid. | |
| 17475884 | 2007 | Lysophospholipids of different classes mobilize neutrophil secretory vesicles and induce redundant signaling through G2A. | |
| 16754659 | 2006 | Stable association between G alpha(q) and phospholipase C beta 1 in living cells. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 16236715 | 2005 | Identification of 9-hydroxyoctadecadienoic acid and other oxidized free fatty acids as ligands of the G protein-coupled receptor G2A. | |
| 15665078 | 2005 | Differential proton sensitivity of related G protein-coupled receptors T cell death-associated gene 8 and G2A expressed in immune cells. | |
| 15653487 | 2005 | Retraction. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15280385 | 2004 | G2A is a proton-sensing G-protein-coupled receptor antagonized by lysophosphatidylcholine. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12805023 | 2003 | Inflammatory stress increases receptor for lysophosphatidylcholine in human microvascular endothelial cells. | |
| 12586833 | 2003 | The lysophospholipid receptor G2A activates a specific combination of G proteins and promotes apoptosis. | |
| 12508121 | 2003 | The DNA sequence and analysis of human chromosome 14. | |
| 12482833 | 2002 | Expression of G2A, a receptor for lysophosphatidylcholine, by macrophages in murine, rabbit, and human atherosclerotic plaques. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12086852 | 2002 | Positron emission tomography imaging analysis of G2A as a negative modifier of lymphoid leukemogenesis initiated by the BCR-ABL oncogene. | |
| 11474113 | 2001 | Lysophosphatidylcholine as a ligand for the immunoregulatory receptor G2A. | |
| 9770487 | 1998 | A DNA damage and stress inducible G protein-coupled receptor blocks cells in G2/M. |
