Property Summary

Ligand Count 256
NCBI Gene PubMed Count 25
PubMed Score 120.04
PubTator Score 75.68

Knowledge Summary

Patent (44,794)

TINX Plot

  Disease (3)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Obesity 678 3.138 1.6

Gene RIF (11)

AA Sequence

MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISGLLTDQLSSPS      1 - 70
RPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGFVAGACIAGLWLVSYLIGFLP     71 - 140
LGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLLFVFFYCDMLKIASMHSQQIRKMEHAGAMAG    141 - 210
GYRSPRTPSDFKALRTVSVLIGSFALSWTPFLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYA    211 - 280
YWQKEVRLQLYHMALGVKKVLTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG                   281 - 335
//

Text Mined References (26)

PMID Year Title