Property Summary

NCBI Gene PubMed Count 20
PubMed Score 37.74
PubTator Score 21.90

Knowledge Summary

Patent (6,753)

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.7e-96
malignant mesothelioma 3232 8.2e-08
osteosarcoma 7950 8.8e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Human immunodeficiency virus infectious disease 138 3.216 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -4.600 8.2e-08
osteosarcoma 1.862 8.8e-06
psoriasis 1.800 1.7e-96

Gene RIF (10)

AA Sequence

MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKT      1 - 70
VTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLI     71 - 140
HPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVK    141 - 210
FIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHH    211 - 280
VMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCL    281 - 350
LETAQ                                                                     351 - 355
//

Text Mined References (22)

PMID Year Title