Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.78
PubTator Score 11.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.400 2.4e-04
diabetes mellitus -1.200 2.5e-03
ovarian cancer 1.700 9.9e-05

Gene RIF (6)

PMID Text
25241168 Gpn1-Gpn3 interaction was essential to maintain steady-state protein levels of both GTPases
22796641 A highly active, evolutionarily conserved nuclear export sequences in XAB1/Gpn1, was identified.
22174317 HIV-1 Rev interacting protein, GPN-loop GTPase 1 (GPN1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21768307 Data show that GPN1/GPN3 define a new family of small GTPases that are specialized for the transport of RNA polymerase II into the nucleus.
20855544 RPAP4/GPN1 is a member of a newly discovered GTPase family that contains a highly conserved GPN loop motif that is essential, along with its GTP-binding motifs, for nuclear localization of POLR2A/RPB1 in a process that also requires microtubule assembly
12588985 relieves MBD2-mediated transcriptional repression and reactivates transcription from methylated promoters

AA Sequence

MAASAAAAELQASGGPRHPVCLLVLGMAGSGKTTFVQRLTGHLHAQGTPPYVINLDPAVHEVPFPANIDI      1 - 70
RDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKYVLIDTPGQIEVFTWSASGTIIT     71 - 140
EALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQ    141 - 210
DALNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSL    211 - 280
ANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEE    281 - 350
SHEEPAFQNFMQESMAQYWKRNNK                                                  351 - 374
//

Text Mined References (30)

PMID Year Title
25241168 2014 Gpn1 and Gpn3 associate tightly and their protein levels are mutually dependent in mammalian cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22796641 2012 A nuclear export sequence in GPN-loop GTPase 1, an essential protein for nuclear targeting of RNA polymerase II, is necessary and sufficient for nuclear export.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21844196 2011 GTP-dependent binding and nuclear transport of RNA polymerase II by Npa3 protein.
21768307 2011 Human GTPases associate with RNA polymerase II to mediate its nuclear import.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21386085 2011 A bivariate genome-wide approach to metabolic syndrome: STAMPEED consortium.
21269460 2011 Initial characterization of the human central proteome.
20864038 2010 HSP90 and its R2TP/Prefoldin-like cochaperone are involved in the cytoplasmic assembly of RNA polymerase II.
20855544 2010 The protein interaction network of the human transcription machinery reveals a role for the conserved GTPase RPAP4/GPN1 and microtubule assembly in nuclear import and biogenesis of RNA polymerase II.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17643375 2007 Systematic analysis of the protein interaction network for the human transcription machinery reveals the identity of the 7SK capping enzyme.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12588985 2003 MBDin, a novel MBD2-interacting protein, relieves MBD2 repression potential and reactivates transcription from methylated promoters.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11124703 2001 Characterization of 16 novel human genes showing high similarity to yeast sequences.
11058119 2000 A novel cytoplasmic GTPase XAB1 interacts with DNA repair protein XPA.