Property Summary

NCBI Gene PubMed Count 26
PubMed Score 24.19
PubTator Score 45.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
interstitial lung disease -2.100 3.6e-02
chronic lymphocytic leukemia 1.991 6.9e-04
astrocytoma -1.200 9.1e-14
glioblastoma -3.300 7.1e-05
osteosarcoma -2.003 3.7e-05
ependymoma -3.000 2.4e-14
sonic hedgehog group medulloblastoma -1.800 8.6e-03
atypical teratoid / rhabdoid tumor -4.100 1.2e-08
medulloblastoma, large-cell -2.500 3.5e-04
primitive neuroectodermal tumor -2.300 6.0e-03
adrenocortical carcinoma -1.837 2.2e-07
non-small cell lung cancer -4.710 4.8e-43
intraductal papillary-mucinous adenoma (... -2.600 3.4e-03
intraductal papillary-mucinous carcinoma... -2.700 3.3e-03
lung cancer -4.900 2.6e-07
colon cancer -5.100 2.9e-12
lung adenocarcinoma -3.100 7.8e-36
pediatric high grade glioma -2.400 2.5e-04
pilocytic astrocytoma -1.700 3.7e-05
aldosterone-producing adenoma -1.269 2.5e-02
lung carcinoma -2.400 3.2e-15
spina bifida 4.189 2.4e-02
ovarian cancer -5.500 7.7e-13
psoriasis -1.300 1.3e-37

 GO Function (1)

Pathway (1)

Protein-protein Interaction (11)

Gene RIF (11)

PMID Text
25224183 findings thus indicate a critical role of correct GPM6A/M6 levels for cognitive function and support a role of the GPM6A duplication for the patient's phenotype
24916915 Data indicate that neuronal membrane glycoproteins GPM6A and GPM6B may act as novel oncogenes in the development of lymphoid leukemia.
23632458 loosing dynamic regulation of neuronal GPM6A expression poses a genetic risk for claustrophobia
23284715 The yeast two-hybrid screen and the coimmunoprecipitation analysis identify the HIV-1 Nef interacting human protein glycoprotein M6A (GPM6A) in cells
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20400778 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19298174 Results suggest that expression level of GPM6A is associated with the differentiation and neuronal migration of neurons derived from undifferentiated human embryonic stem cells.
18574501 Results indicate that M6a modulates mu-opioid receptor endocytosis and post-endocytotic sorting and has an important role in receptor regulation.
18163405 GMP6A plays a role in the stress-induced hippocampal alterations that are found in psychiatric disorders in general and schizophrenia in particular.
18163405 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQTYFEMARTAGD      1 - 70
TLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLA     71 - 140
WLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELNMT    141 - 210
FHLFIVALAGAGAAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT      211 - 278
//

Text Mined References (29)

PMID Year Title
25224183 2014 Altered GPM6A/M6 dosage impairs cognition and causes phenotypes responsive to cholesterol in human and Drosophila.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24916915 2014 Identification of GPM6A and GPM6B as potential new human lymphoid leukemia-associated oncogenes.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
23632458 2013 A single gene defect causing claustrophobia.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22365631 2012 Genome-wide association study of temperament in bipolar disorder reveals significant associations with three novel Loci.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20400778 2010 Genomic variation associated with mortality among adults of European and African ancestry with heart failure: the cohorts for heart and aging research in genomic epidemiology consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19298174 2009 Human GPM6A is associated with differentiation and neuronal migration of neurons derived from human embryonic stem cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18574501 2008 Membrane glycoprotein M6A promotes mu-opioid receptor endocytosis and facilitates receptor sorting into the recycling pathway.
18163405 2008 Do mood symptoms subdivide the schizophrenia phenotype? Association of the GMP6A gene with a depression subgroup.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15822905 Phosphoproteomic analysis of synaptosomes from human cerebral cortex.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12493773 2003 Global profiling of the cell surface proteome of cancer cells uncovers an abundance of proteins with chaperone function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359212 2002 M6a acts as a nerve growth factor-gated Ca(2+) channel in neuronal differentiation.
8893821 1996 Isolation and mapping of the human glycoprotein M6 gene (GPM6A) to 4q33-->q34.
8807448 1996 Expression of members of the proteolipid protein gene family in the developing murine central nervous system.
8661015 1996 Chromosomal mapping of the human M6 genes.