Property Summary

NCBI Gene PubMed Count 53
PubMed Score 125.16
PubTator Score 716.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.300 3.9e-02
oligodendroglioma 1.700 1.7e-03
cutaneous lupus erythematosus -1.600 1.6e-02
psoriasis 2.700 5.4e-05
osteosarcoma -1.951 2.1e-06
glioblastoma -1.600 1.7e-04
medulloblastoma, large-cell -1.700 7.5e-04
Atopic dermatitis -2.100 1.9e-04
lung cancer 1.200 2.5e-02
pediatric high grade glioma -1.300 1.1e-03
non primary Sjogren syndrome sicca -1.200 1.8e-02
subependymal giant cell astrocytoma -2.670 1.3e-02
lung carcinoma 1.100 2.6e-17
ovarian cancer -1.200 8.0e-06
pituitary cancer 1.300 3.7e-03

Gene RIF (27)

PMID Text
26567912 Low aggressive MCF-7 breast cancer cells have low endogenous PLD enzymatic activity and cell invasion, concomitant with high expression of miR-203, -887, and -3619 and miR-182 and miR-182.
26341143 An observed increase in PLD activity was mediated through boosting the binding of PLD with dynamin which in turn facilitated fibronectin-induced cell spreading.
25964559 our findings showed that ANRIL is an lncRNA responsible in anti-tumorigenesis caused by PLD inhibition and combined incorporation of ANRIL into PLD inhibition-induced anti-tumorigenic signaling network
25867459 suggest that the down-regulation of GPI-PLD protein may be involved in prion propagation in the brains of prion diseases
25632961 AMPK suppresses PLD activity, and PLD suppresses AMPK via mTOR.
24990954 At the cellular level, PLD and its reaction product, phosphatidate, interact with a large number of protein partners that are directly related to the actin cytoskeleton and cell migration.
24990952 Phospholipase D and the maintenance of phosphatidic acid levels for regulation of mammalian target of rapamycin (mTOR).
24990948 Functional regulation of phospholipase D expression in cancer and inflammation.
24956203 PLD1 and PLD2 mutants inhibit very-low-density lipoprotein-induced aldosterone production in HAC15 cells.
22481092 This study indicated that PLD participates in the same signaling pathway in this breast cancer cell line.
22260953 genetic variation of GPLD1 appears to associate with circulating glycosylphosphatidylinositol-specific phospholipase D levels
21131602 This study revealed the novel mechanism of bleomycin-induced redox-sensitive activation of phospholipase D leading to the generation of phosphaticid acid.
20858461 The role of phospholipase D in the transport of VAT1 to plasma membranes and in phosphatidic acid metabolism in neutrophils is reported.
20648472 Observational study of gene-disease association. (HuGE Navigator)
20137110 The mRNA expression and activity of GPI-PLD in de novo and refractory or relapsed acute myeloid leukemia patients are obviously higher than those in normal controls.
19460752 Knockdown of glycosylphosphatidylinositol specific phospholipase D1 (GPLD1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19135435 The serum GPI-PLD activities, the protein and mRNA levels of GPI-PLD in hepatocellular carcinoma patients were decreased by 40%, 60% and 56%, respectively.
18940312 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18298948 We show that human PLD1b and PLD2a contain functional caspase 3 cleavage sites and identify the critical aspartate residues within PLD1b that affect its activation by phorbol esters.
17949898 Data indicate that a critical component of Ras signaling is the activation of PLD.
17467053 GPI-PLD probably had no contribution to hematopoietic stem cell homing, which may due to its low or no expression in cord blood, bone marrow and mobilized peripheral blood CD34(+) cells.
16831865 Data describe the role of angiotensin II type 1A receptor phosphorylation, phospholipase D, and extracellular calcium in isoform-specific protein kinase C membrane translocation responses.
15814706 CTLA-4 may be stored in a specialized compartment in regulatory T cells that can be triggered rapidly for deployment to the plasma membrane in a phospholipase D- and ADP ribosylation factor-1-dependent manner
15500962 PLD activation is a novel finding for the D(3) receptor, and is the first example of an effector system where D(3) signals without G(i)/G(o) protein intermediates.
15500911 identified as component of human trypanosome lytic factor 1 (TLF1)
14767861 increased serum glycosylphosphatidylinositol-specific phospholipase D is associated with insulin resistance in a cohort with a wide range of insulin sensitivity
12090469 In human ovarian cancer cell lines, GPI-PLD mRNA expression correlated with GPI-PLD enzyme activity and with the shedding of the GPI-anchored tumor and prognostic markers, urokinase receptor and CA125, from the cell surface.

AA Sequence

MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCF      1 - 70
YPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQG     71 - 140
FLRTMGAIDFHGSYSEAHSAGDFGGDVLSQFEFNFNYLARRWYVPVKDLLGIYEKLYGRKVITENVIVDC    141 - 210
SHIQFLEMYGEMLAVSKLYPTYSTKSPFLVEQFQEYFLGGLDDMAFWSTNIYHLTSFMLENGTSDCNLPE    211 - 280
NPLFIACGGQQNHTQGSKMQKNDFHRNLTTSLTESVDRNINYTERGVFFSVNSWTPDSMSFIYKALERNI    281 - 350
RTMFIGGSQLSQKHVSSPLASYFLSFPYARLGWAMTSADLNQDGHGDLVVGAPGYSRPGHIHIGRVYLIY    351 - 420
GNDLGLPPVDLDLDKEAHRILEGFQPSGRFGSALAVLDFNVDGVPDLAVGAPSVGSEQLTYKGAVYVYFG    421 - 490
SKQGGMSSSPNITISCQDIYCNLGWTLLAADVNGDSEPDLVIGSPFAPGGGKQKGIVAAFYSGPSLSDKE    491 - 560
KLNVEAANWTVRGEEDFSWFGYSLHGVTVDNRTLLLVGSPTWKNASRLGHLLHIRDEKKSLGRVYGYFPP    561 - 630
NGQSWFTISGDKAMGKLGTSLSSGHVLMNGTLKQVLLVGAPTYDDVSKVAFLTVTLHQGGATRMYALTSD    631 - 700
AQPLLLSTFSGDRRFSRFGGVLHLSDLDDDGLDEIIMAAPLRIADVTSGLIGGEDGRVYVYNGKETTLGD    701 - 770
MTGKCKSWITPCPEEKAQYVLISPEASSRFGSSLITVRSKAKNQVVIAAGRSSLGARLSGALHVYSLGSD    771 - 840
//

Text Mined References (54)

PMID Year Title
26567912 2016 Down-regulation of MicroRNAs (MiRs) 203, 887, 3619 and 182 Prevents Vimentin-triggered, Phospholipase D (PLD)-mediated Cancer Cell Invasion.
26341143 2015 GTP-dependent interaction between phospholipase D and dynamin modulates fibronectin-induced cell spreading.
25964559 2015 Down-regulation of Phospholipase D Stimulates Death of Lung Cancer Cells Involving Up-regulation of the Long ncRNA ANRIL.
25867459 2015 Phosphatidylinositol-glycan-phospholipase D is involved in neurodegeneration in prion disease.
25632961 2015 Reciprocal regulation of AMP-activated protein kinase and phospholipase D.
24990954 2014 Thematic minireview series on phospholipase D and cancer.
24990952 2014 Phospholipase D and the maintenance of phosphatidic acid levels for regulation of mammalian target of rapamycin (mTOR).
24990948 2014 Functional regulation of phospholipase D expression in cancer and inflammation.
24956203 2014 Phospholipase D activity underlies very-low-density lipoprotein (VLDL)-induced aldosterone production in adrenal glomerulosa cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22481092 2012 Paxillin phosphorylation and complexing with Erk and FAK are regulated by PLD activity in MDA-MB-231 cells.
22260953 2012 Genetic variation of GPLD1 associates with serum GPI-PLD levels: a preliminary study.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21131602 2011 Pulmonary fibrosis inducer, bleomycin, causes redox-sensitive activation of phospholipase D and cytotoxicity through formation of bioactive lipid signal mediator, phosphatidic acid, in lung microvascular endothelial cells.
20858461 2011 An essential role for phospholipase D in the recruitment of vesicle amine transport protein-1 to membranes in human neutrophils.
20648472 2010 PNPLA3 variants specifically confer increased risk for histologic nonalcoholic fatty liver disease but not metabolic disease.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20137110 2010 [Expression and activity of glycosylphosphatidylinositol-specific phospholipase d mRNA in bone marrow mononuclear cells isolated from patient with acute myeloid leukemia and their significance].
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19135435 2009 Important roles of glycosylphosphatidylinositol (GPI)-specific phospholipase D and some GPI-anchored proteins in the pathogenesis of hepatocellular carcinoma.
18940312 2008 Population-based genome-wide association studies reveal six loci influencing plasma levels of liver enzymes.
18328347 2008 Plasma glycosylphosphatidylinositol-specific phospholipase D predicts the change in insulin sensitivity in response to a low-fat but not a low-carbohydrate diet in obese women.
18298948 2008 Identification of caspase 3 motifs and critical aspartate residues in human phospholipase D1b and phospholipase D2a.
17949898 2007 Phospholipase D provides a survival signal in human cancer cells with activated H-Ras or K-Ras.
17897319 2007 Integral and associated lysosomal membrane proteins.
17761367 2007 Statin therapy reduces serum levels of glycosylphosphatidylinositol-specific phospholipase D.
17720976 2007 Growth factor induction of Cripto-1 shedding by glycosylphosphatidylinositol-phospholipase D and enhancement of endothelial cell migration.
17467053 2007 Role of glycosylphosphatidylinositol-specific phospholipase D in the homing of umbilical cord blood, mobilized peripheral blood and bone marrow-derived hematopoietic stem/progenitor cells.
17368745 2007 How Glycosylphosphatidylinositol-phospholipase D acts in homing of hematopoietic stem/progenitor cells?
16831865 2006 Role of angiotensin II type 1A receptor phosphorylation, phospholipase D, and extracellular calcium in isoform-specific protein kinase C membrane translocation responses.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15907827 2005 Effect of glycosylphosphatidylinositol specific phospholipase D gene expression levels on complement mediated killing of leukemic cells in patients with chronic myeloid leukemia.
15814706 2005 Exocytosis of CTLA-4 is dependent on phospholipase D and ADP ribosylation factor-1 and stimulated during activation of regulatory T cells.
15500962 2004 D3 dopamine receptor activates phospholipase D through a pertussis toxin-insensitive pathway.
15500911 2004 Characterization of primate trypanosome lytic factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14767861 2004 Insulin resistance is associated with increased serum levels of glycosylphosphatidylinositol-specific phospholipase D.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12536633 2001 [Preliminary study of the gene structure of human glycosylphosphatidylinositol specific phospholipase D].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12367767 2002 Different distributions of human bone alkaline phosphatase isoforms in serum and bone tissue extracts.
12090469 2002 GPI-specific phospholipase D mRNA expression in tumor cells of different malignancy.
11989719 2002 Phosphorylation decreases trypsin activation and apolipoprotein al binding to glycosylphosphatidylinositol-specific phospholipase D.
11939719 2002 Sensory nerves in central and peripheral control of pancreatic integrity by leptin and melatonin.
11939716 2002 Screening and modulation of extracellular signals by mucous barrier. Serum glycosylphosphatidylinositol phospholipase D (GPI-PLD) releases protective mucous barrier from oral mucosa.
11938765 1999 [Methodological study on the assay of glycosylphosphatidylinositol-specific phospholipase D activity in serum].
11254757 2001 GPI-specific phospholipase D associates with an apoA-I- and apoA-IV-containing complex.
11072085 2000 Structure and expression of the human glycosylphosphatidylinositol phospholipase D1 (GPLD1) gene.
10752311 1999 Characterization of phospholipase D activation by GM2 activator in a cell-free system.
7512501 1994 Release of GPI-anchored membrane proteins by a cell-associated GPI-specific phospholipase D.
2760042 1989 Purification of a glycosyl-phosphatidylinositol-specific phospholipase D from human plasma.
2017684 1991 Primary structure and functional activity of a phosphatidylinositol-glycan-specific phospholipase D.
1833386 1991 Production of the glycosylphosphatidylinositol-specific phospholipase D by the islets of Langerhans.
1606959 1992 Phosphatidylinositol-glycan-specific phospholipase D is an amphiphilic glycoprotein that in serum is associated with high-density lipoproteins.