Property Summary

NCBI Gene PubMed Count 86
PubMed Score 706.11
PubTator Score 1444.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Congenital hemolytic anemia 32 0.0 4.0
Disease Target Count
Hemolytic anemia 77

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.600 1.6e-02
Breast cancer 1.400 3.6e-11
lung adenocarcinoma 1.496 2.0e-08
lung cancer 1.500 1.3e-03
Multiple myeloma 2.539 1.8e-04
non-small cell lung cancer 1.554 2.6e-22
oligodendroglioma -1.100 2.9e-10
ovarian cancer 3.200 9.4e-07
Pick disease -1.200 3.2e-03
Waldenstrons macroglobulinemia 1.428 2.6e-02

Gene RIF (53)

AA Sequence

MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVD      1 - 70
LAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGD     71 - 140
WKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIAS    141 - 210
KTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAI    211 - 280
GLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAA    281 - 350
YFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL    351 - 420
HHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGAL    421 - 490
VAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ      491 - 558
//

Text Mined References (102)

PMID Year Title