Property Summary

NCBI Gene PubMed Count 81
PubMed Score 658.95
PubTator Score 1444.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.428 2.6e-02
Multiple myeloma 2.539 1.8e-04
astrocytic glioma -1.600 1.6e-02
oligodendroglioma -1.100 2.9e-10
non-small cell lung cancer 1.554 2.6e-22
lung cancer 2.100 6.4e-05
lung adenocarcinoma 1.496 2.0e-08
Pick disease -1.200 3.2e-03
Breast cancer 1.400 3.6e-11
ovarian cancer 3.200 9.4e-07

Protein-protein Interaction (10)

Gene RIF (48)

PMID Text
26579829 Results showed an increase in GPI and AMFR in clear cell-renal cell carcinoma cells, and their colocalization on plasma membrane. Kaplan-Meier curves showed significant differences in survival among groups of patients with high versus low GPI.
26573126 NLK is able to promote cell proliferation and type II collagen synthesis during in vitro chondrocyte propagation.
26308071 Suggest tha AMF/PGI-mediated tumorigenesis occurs through MAPK-ERK signaling in endometrial carcinoma.
26201353 Study supports a role for AMF mediating epithelial-mesenchymal transition in endometrial cancer (EC) through MAPK signaling. Therefore, AMF may provide a potential prognostic and therapeutic target in preventing EC progression.
25910678 The association of ENO1 and GPI with postthaw sperm viability and motility was confirmed using Pearson's linear correlation. ENO1 and GPI can be used as markers of human sperm freezability before starting the cryopreservation procedure.
24440856 High GPI expression is associated with metastatic phenotype of breast cancer.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of glucose-6-phosphate isomerase (GPI) expression by HIV-1 Vpr in Vpr transduced macrophages
23773638 Serum anti-GPI autoantibodies are useful for the diagnosis of rheumatoid arthritis in Chinese patients.
23248119 Findings suggest that autocrine motility factor (AMF)-HER2 interaction might be a novel target for therapeutic management of patients with breast cancer, whose disease is resistant to trastuzumab.
23166591 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of glucose-6-phosphate isomerase (GPI) expression by HIV-1 Vpr in Vpr transduced macrophages
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21970785 For PGI, an extended active site in which residues in the first, second, and third layers around the reacting substrate are predicted.
21555518 GPI is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21252914 By regulating ER calcium release, AMF/PGI interaction with gp78/AMFR therefore protects against ER stress identifying novel roles for these cancer-associated proteins in promoting tumor cell survival.
20978190 Data show that effective downregulation of AMF/PGI expression and subsequent abrogation of AMF/PGI secretion, which resulted in morphologic change with reduced growth, motility, and invasion.
20845477 Observational study of gene-disease association. (HuGE Navigator)
20810510 Data suggest that elevated serum glucose-6-phosphate isomerase may be involved in the synovitis of rheumatoid arthritis and may prove useful as a serum marker for disease activity.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19819066 autocrine motility factor/phosphoglucose isomerase against TGF-beta-induced apoptosis was correlated with its enzymatic activity
19801670 melanoma migration induced by AMF is mediated by autocrine production of IL-8 as a novel downstream modulator of the AMF signaling pathway
19787266 overexpression of PGI significantly contributes to the aggressive phenotype of human colon cancer
19531650 Expression of this protein leads to mesenchymal-topepithelial transition in breast cancer cells.
19064002 Mutations effect catalytic activity and structural stability of human glucose-6-phosphate isomerase.
18992137 Peptide fragment glucose phosphate isomerase (GPI)325-339 is identified as a major epitope in GPI-induced arthritis, with potential to induce polyarthritis.
18485900 Results of this study suggest that AMF stimulation stimulates MMP3 expression via a MAPK signaling pathway.
18311788 IL-6 and Th17 play an essential role in GPI-induced arthritis
17925402 PGI/AMF is involved in oxidative stress-induced cellular senescence and should bring novel insights into the control of cellular growth leading to a new methodology for cancer treatment.
17690101 raft-dependent endocytosis of AMF follows a distinct phosphatidylinositol 3-kinase-dependent pathway that is up-regulated in more aggressive tumor cells
17071500 the receptor molecule for AMF/NLK/MF in leukemic differentiation is not gp78
17041899 Missense mutations c.341A>T (p.Asp113Val) in exon 4 and c.663T>G (p.Asn220Lys) in exon 7 are associated with hereditary nonspherocytic hemolytic anemia.
16949042 elevated G6PI levels present in patients with immune-based inflammatory arthritis may contribute to elevated levels of anti-G6PI Abs and G6PI/anti-G6PI immune complexes
16563432 N-glyco side-chain of AMFR is a trigger and that interaction between the 117-C-terminal part of AMF and the extracellular core protein of autocrine motility factor receptor (AMFR) is needed during AMF-AMFR interactions
15850830 interaction with hypoxia-inducible factor-1 drives mobility of erythroid progenitor cells
15637053 phosphoglucose isomerase/autocrine motility factor activities are differentially regulated by protein kinase CK2 phosphorylation
15570012 AMF expression significantly contributes to the aggressive phenotype of pancreatic cancer
15369782 Our results suggest that GPI variants may play a crucial role in the production of autoantibodies against ubiquitous GPI autoantigens.
15290745 In addition to the findings in rheumatoid arthritis, our results indicate that GPI is not a general target of autoantibodies in juvenile idiopathic arthritis.
15034067 T-cell dependent peripheral polyarthritis induced by recombinant human glucose-6-phosphate isomerase in genetically unaltered mice demonstrates for the first time the induction of organ-specific disease by systemic autoimmunity.
14715248 The observations are consistent with a downstream mediation role of MMP-3 in Pohophoglucose isomerase/AMF-stimulated tumor cell metastasis.
14566819 AMF regulates expression of Apaf-1 and caspase-9 genes via a complex signaling pathway and indirectly regulates formation of the apoptosome. (autocrine motility factor)
12783864 role in regulating cell proliferation
12737943 This study suggests that the metabolic consequences of a combined deficiency of GPI and G6PD might be responsible for a different clinical outcome, severe congenital hemolytic anemia, than predicted for either defect in isolation.
12573240 crystal structure and analysis of the initial ring-opening step of catalysis
12527360 The results demonstrate that the enzymatic activity of PGI is not essential for either receptor binding or cytokine function of human PGI.
12517804 Overexpression induces neoplastic transformation and survival of NIH-3T3 fibroblasts.
11688991 hypoxia-induced gene in pancreatic cancer cell lines
11004567 PGI is a moonlighting protein that functions as a cytosolic enzyme involved in glycolysis and gluconeogenesis, and as cytokine through binding to its cell surface receptor.
2547084 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of glucose-6-phosphate isomerase (GPI) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVD      1 - 70
LAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGD     71 - 140
WKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIAS    141 - 210
KTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAI    211 - 280
GLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAA    281 - 350
YFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL    351 - 420
HHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGAL    421 - 490
VAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ      491 - 558
//

Text Mined References (97)

PMID Year Title
26579829 2015 Increased Expression of the Autocrine Motility Factor is Associated With Poor Prognosis in Patients With Clear Cell-Renal Cell Carcinoma.
26573126 2016 Microfluidics?based optimization of neuroleukin?mediated regulation of articular chondrocyte proliferation.
26308071 2015 AMF/PGI-mediated tumorigenesis through MAPK-ERK signaling in endometrial carcinoma.
26201353 2015 Autocrine motility factor promotes epithelial-mesenchymal transition in endometrial cancer via MAPK signaling pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25910678 2015 Enolase1 (ENO1) and glucose-6-phosphate isomerase (GPI) are good markers to predict human sperm freezability.
24810856 2014 Polyubiquitylation of AMF requires cooperation between the gp78 and TRIM25 ubiquitin ligases.
24440856 2014 GPI/AMF inhibition blocks the development of the metastatic phenotype of mature multi-cellular tumor spheroids.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23773638 2013 Comparison of anti-mutated citrullinated vimentin, anti-cyclic citrullinated peptides, anti-glucose-6-phosphate isomerase and anti-keratin antibodies and rheumatoid factor in the diagnosis of rheumatoid arthritis in Chinese patients.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23248119 2013 Autocrine motility factor promotes HER2 cleavage and signaling in breast cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21970785 2011 A tale of two isomerases: compact versus extended active sites in ketosteroid isomerase and phosphoglucose isomerase.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21269460 2011 Initial characterization of the human central proteome.
21252914 2011 Autocrine motility factor/phosphoglucose isomerase regulates ER stress and cell death through control of ER calcium release.
20978190 2010 Silencing of autocrine motility factor induces mesenchymal-to-epithelial transition and suppression of osteosarcoma pulmonary metastasis.
20845477 2011 Glucose metabolism gene polymorphisms and clinical outcome in pancreatic cancer.
20810510 2010 Elevated serum glucose-6-phosphate isomerase correlates with histological disease activity and clinical improvement after initiation of therapy in patients with rheumatoid arthritis.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19946888 2010 Defining the membrane proteome of NK cells.
19819066 2010 PI 3-kinase/Akt and STAT3 are required for the prevention of TGF-beta-induced Hep3B cell apoptosis by autocrine motility factor/phosphoglucose isomerase.
19801670 2009 Phosphoglucose isomerase/autocrine motility factor promotes melanoma cell migration through ERK activation dependent on autocrine production of interleukin-8.
19787266 2009 Phosphoglucose isomerase enhances colorectal cancer metastasis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19531650 2009 Phosphoglucose isomerase/autocrine motility factor mediates epithelial and mesenchymal phenotype conversions in breast cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19064002 2009 Effects of inherited mutations on catalytic activity and structural stability of human glucose-6-phosphate isomerase expressed in Escherichia coli.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18992137 2008 Arthritogenic T cell epitope in glucose-6-phosphate isomerase-induced arthritis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18485900 2008 Autocrine motility factor stimulates the invasiveness of malignant cells as well as up-regulation of matrix metalloproteinase-3 expression via a MAPK pathway.
18311788 2008 Crucial role of the interleukin-6/interleukin-17 cytokine axis in the induction of arthritis by glucose-6-phosphate isomerase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17925402 2007 Down-regulation of phosphoglucose isomerase/autocrine motility factor expression sensitizes human fibrosarcoma cells to oxidative stress leading to cellular senescence.
17690101 2007 Raft-dependent endocytosis of autocrine motility factor is phosphatidylinositol 3-kinase-dependent in breast carcinoma cells.
17071500 2006 AMF/G6PI induces differentiation of leukemic cells via an unknown receptor that differs from gp78.
17041899 2006 Red cell glucose phosphate isomerase (GPI): a molecular study of three novel mutations associated with hereditary nonspherocytic hemolytic anemia.
16949042 2006 Patients with inflammatory arthritic diseases harbor elevated serum and synovial fluid levels of free and immune-complexed glucose-6-phosphate isomerase (G6PI).
16563432 2006 The autocrine motility factor (AMF) and AMF-receptor combination needs sugar chain recognition ability and interaction using the C-terminal region of AMF.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16139798 2005 Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.
15850830 2005 Hypoxia-inducible factor-1 drives the motility of the erythroid progenitor cell line, UT-7/Epo, via autocrine motility factor.
15637053 2005 Differential regulation of phosphoglucose isomerase/autocrine motility factor activities by protein kinase CK2 phosphorylation.
15570012 2004 Autocrine motility factor signaling enhances pancreatic cancer metastasis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15369782 2004 Glucose-6-phosphate isomerase variants play a key role in the generation of anti-GPI antibodies: possible mechanism of autoantibody production.
15290745 2004 Autoantibodies in juvenile idiopathic arthritis: glucose-6-phosphate isomerase is not a specific target.
15059907 2004 Insulin-like growth factor binding protein-3 interacts with autocrine motility factor/phosphoglucose isomerase (AMF/PGI) and inhibits the AMF/PGI function.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15034067 2004 Immunization with glucose-6-phosphate isomerase induces T cell-dependent peripheral polyarthritis in genetically unaltered mice.
14715248 2004 Induction of hepatoma cells migration by phosphoglucose isomerase/autocrine motility factor through the upregulation of matrix metalloproteinase-3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14566819 2003 Autocrine motility factor signaling induces tumor apoptotic resistance by regulations Apaf-1 and Caspase-9 apoptosome expression.
12783864 2003 Regulation of cell proliferation by autocrine motility factor/phosphoglucose isomerase signaling.
12777791 2003 The structure of human phosphoglucose isomerase complexed with a transition-state analogue.
12737943 Combined glucose-6-phosphate dehydrogenase and glucosephosphate isomerase deficiency can alter clinical outcome.
12573240 2003 Crystal structure of human phosphoglucose isomerase and analysis of the initial catalytic steps.
12527360 2003 The enzymatic activity of phosphoglucose isomerase is not required for its cytokine function.
12517804 2003 Overexpression of the autocrine motility factor/phosphoglucose isomerase induces transformation and survival of NIH-3T3 fibroblasts.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163179 2002 Species specificity of the cytokine function of phosphoglucose isomerase.
12054796 2002 Inhibition mechanism of cytokine activity of human autocrine motility factor examined by crystal structure analyses and site-directed mutagenesis studies.
11896393 2002 Dynamic visualization of a joint-specific autoimmune response through positron emission tomography.
11896391 2002 How antibodies to a ubiquitous cytoplasmic enzyme may provoke joint-specific autoimmune disease.
11688991 2001 Identification of genes differentially induced by hypoxia in pancreatic cancer cells.
11437381 2001 Tumor autocrine motility factor is an angiogenic factor that stimulates endothelial cell motility.
11431735 2001 Autocrine motility factor enhances hepatoma cell invasion across the basement membrane through activation of beta1 integrins.
11418246 2001 The human GPI1 gene is required for efficient glycosylphosphatidylinositol biosynthesis.
11371164 2001 The crystal structure of human phosphoglucose isomerase at 1.6 A resolution: implications for catalytic mechanism, cytokine activity and haemolytic anaemia.
11264592 2001 Human phosphoglucose isomerase: expression, purification, crystallization and preliminary crystallographic analysis.
11004567 2000 Phosphohexose isomerase/autocrine motility factor/neuroleukin/maturation factor is a multifunctional phosphoprotein.
10916680 2000 Glucose-6-phosphate isomerase deficiency.
10727272 2000 Cloning of a glucose phosphate isomerase/neuroleukin-like sperm antigen involved in sperm agglutination.
10216265 1999 Fine mapping of a polymorphic CA repeat marker on human chromosome 19 and its use in population studies.
9856489 1998 Molecular basis of neurological dysfunction coupled with haemolytic anaemia in human glucose-6-phosphate isomerase (GPI) deficiency.
9616041 1998 Expression and enzymatic characterization of human glucose phosphate isomerase (GPI) variants accounting for GPI deficiency.
9446754 1997 Glucosephosphate isomerase (GPI) deficiency mutations associated with hereditary nonspherocytic hemolytic anemia (HNSHA).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8822954 1996 Molecular analysis of glucose phosphate isomerase deficiency associated with hereditary hemolytic anemia.
8822952 1996 Study of the molecular defects in glucose phosphate isomerase-deficient patients affected by chronic hemolytic anemia.
8575767 1995 Human glucose phosphate isomerase: exon mapping and gene structure.
8499925 1993 DNA sequence abnormalities in human glucose 6-phosphate isomerase deficiency.
7989588 1994 The characterization of gene mutations for human glucose phosphate isomerase deficiency associated with chronic hemolytic anemia.
7545951 1994 Identification of a novel tandemly repeated sequence present in an intron of the glucose phosphate isomerase (GPI) gene in mouse and man.
7435496 1980 The first stable variant of erythrocyte glucose-phosphate isomerase associated with severe hemolytic anemia.
3352745 1988 Mouse glucose-6-phosphate isomerase and neuroleukin have identical 3' sequences.
3020690 1986 Neuroleukin: a lymphokine product of lectin-stimulated T cells.
2544027 1989 Isolation of single-copy human genes from a library of yeast artificial chromosome clones.
2387591 1990 Characterization of the 5' end of the gene for human glucose phosphate isomerase (GPI).