Property Summary

NCBI Gene PubMed Count 10
PubMed Score 43.02
PubTator Score 44.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Gene RIF (7)

AA Sequence

MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRY      1 - 70
SVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY                71 - 129
//

Text Mined References (10)

PMID Year Title