Tbio | Glycerol-3-phosphate dehydrogenase 1-like protein |
Plays a role in regulating cardiac sodium current; decreased enzymatic activity with resulting increased levels of glycerol 3-phosphate activating the DPD1L-dependent SCN5A phosphorylation pathway, may ultimately lead to decreased sodium current; cardiac sodium current may also be reduced due to alterations of NAD(H) balance induced by DPD1L.
The protein encoded by this gene catalyzes the conversion of sn-glycerol 3-phosphate to glycerone phosphate. The encoded protein is found in the cytoplasm, associated with the plasma membrane, where it binds the sodium channel, voltage-gated, type V, alpha subunit (SCN5A). Defects in this gene are a cause of Brugada syndrome type 2 (BRS2) as well as sudden infant death syndrome (SIDS). [provided by RefSeq, Jul 2010]
The protein encoded by this gene catalyzes the conversion of sn-glycerol 3-phosphate to glycerone phosphate. The encoded protein is found in the cytoplasm, associated with the plasma membrane, where it binds the sodium channel, voltage-gated, type V, alpha subunit (SCN5A). Defects in this gene are a cause of Brugada syndrome type 2 (BRS2) as well as sudden infant death syndrome (SIDS). [provided by RefSeq, Jul 2010]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Brugada Syndrome 2 | 1 | 0.0 | 0.0 |
Fatty Liver | 70 | 0.0 | 0.0 |
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2890 | 5.7e-15 |
psoriasis | 6694 | 5.7e-11 |
lung adenocarcinoma | 2716 | 4.1e-10 |
atypical teratoid / rhabdoid tumor | 5112 | 1.0e-06 |
malignant mesothelioma | 3232 | 1.2e-06 |
glioblastoma | 5792 | 6.3e-06 |
group 4 medulloblastoma | 1855 | 4.2e-05 |
nasopharyngeal carcinoma | 1058 | 8.4e-05 |
adult high grade glioma | 3801 | 9.3e-05 |
ovarian cancer | 8520 | 1.2e-04 |
interstitial cystitis | 2312 | 2.1e-04 |
lung cancer | 4740 | 3.4e-04 |
Breast cancer | 3578 | 1.0e-03 |
medulloblastoma, large-cell | 6241 | 3.0e-03 |
active ulcerative colitis | 764 | 7.0e-03 |
primitive neuroectodermal tumor | 3035 | 8.1e-03 |
astrocytic glioma | 2597 | 8.2e-03 |
osteosarcoma | 7950 | 1.0e-02 |
colon cancer | 1478 | 1.5e-02 |
ependymoma | 4679 | 4.4e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Short QT syndrome | 12 | 3.02 | 1.5 |
Disease | Target Count |
---|---|
Brugada syndrome | 29 |
Disease | log2 FC | p |
---|---|---|
active ulcerative colitis | -1.250 | 7.0e-03 |
adult high grade glioma | -1.400 | 9.3e-05 |
astrocytic glioma | -1.600 | 8.2e-03 |
atypical teratoid / rhabdoid tumor | -1.700 | 1.0e-06 |
Breast cancer | -1.300 | 1.0e-03 |
colon cancer | -1.200 | 1.5e-02 |
ependymoma | -1.900 | 4.4e-02 |
glioblastoma | -1.600 | 6.3e-06 |
group 4 medulloblastoma | -1.900 | 4.2e-05 |
interstitial cystitis | -1.400 | 2.1e-04 |
lung adenocarcinoma | -1.300 | 4.1e-10 |
lung cancer | -1.300 | 3.4e-04 |
malignant mesothelioma | -1.500 | 1.2e-06 |
medulloblastoma, large-cell | -1.500 | 3.0e-03 |
nasopharyngeal carcinoma | -1.100 | 8.4e-05 |
non-small cell lung cancer | -1.541 | 5.7e-15 |
osteosarcoma | -1.298 | 1.0e-02 |
ovarian cancer | -1.500 | 1.2e-04 |
primitive neuroectodermal tumor | -1.300 | 8.1e-03 |
psoriasis | -1.400 | 5.7e-11 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA |
MAAAPLKVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETVNGRKLTDIINNDHENVKYLPGHK 1 - 70 LPENVVAMSNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGIDEGPEGLKLISDIIRE 71 - 140 KMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLLFKELLQTPNFRITVVDDADTVELCGALKNIVA 141 - 210 VGAGFCDGLRCGDNTKAAVIRLGLMEMIAFARIFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFA 211 - 280 RTGKTIEELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPVQEMLSCLQSHPEH 281 - 350 T//