Property Summary

NCBI Gene PubMed Count 25
PubMed Score 59.26
PubTator Score 63.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy -1.028 4.3e-03
Atopic dermatitis -1.300 1.2e-02
breast carcinoma -2.400 1.2e-03
Duchenne muscular dystrophy -1.056 2.6e-05
ductal carcinoma in situ -1.300 3.9e-03
fibroadenoma -3.100 1.6e-02
invasive ductal carcinoma -1.300 2.8e-02
lung adenocarcinoma -1.400 1.9e-12
lung carcinoma -1.900 5.6e-12
nephrosclerosis -1.252 5.1e-03
non-small cell lung cancer -1.184 1.3e-16
pancreatic ductal adenocarcinoma liver m... -1.365 4.2e-02
psoriasis 1.700 9.6e-04

Protein-protein Interaction (3)

Gene RIF (12)

AA Sequence

MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLP      1 - 70
PNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERL     71 - 140
GIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVG    141 - 210
AGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFART    211 - 280
GKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHM     281 - 349
//

Text Mined References (29)

PMID Year Title