Property Summary

NCBI Gene PubMed Count 50
PubMed Score 44.74
PubTator Score 47.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.400 2.0e-03
posterior fossa group B ependymoma -4.300 6.4e-17
oligodendroglioma -2.300 3.8e-03
glioblastoma -3.200 2.5e-04
sonic hedgehog group medulloblastoma -4.000 6.5e-07
atypical teratoid / rhabdoid tumor -2.400 6.7e-03
medulloblastoma, large-cell -3.900 6.4e-05
primitive neuroectodermal tumor -3.000 6.1e-04
pediatric high grade glioma -3.200 7.7e-06
lung carcinoma -1.100 1.1e-06
psoriasis -1.400 3.9e-14

 CSPA Cell Line (1)

Gene RIF (37)

PMID Text
25999661 Results suggest a potential association between CRP and GPC5 variants with lung cancer risk; variation in GKN1 is associated with chemotherapy response in the Chinese Han population.
25818666 miR-709 may positively regulate invasion and metastasis of hepatocellular carcinoma through targeting GPC5.
24943672 gene variants in IRF5, IRF8 and GPC5 were not associated with risk of relapse or disease progression in multiple sclerosis
24682381 GPC5, a tumor suppressor, is regulated by miR-620 in lung adenocarcinoma.
24456789 Variants in the 50-upstream region of GPC5 confer risk of lung cancer in never smokers
24135429 These results indicate that GPC5 polymorphisms would be useful genetic indicators for Inflammatory demyelinating diseasess, including neuromyelitis optica and multiple sclerosis .
24130709 The IL7R, TNFRSF1A, and GPC5 polymorphisms tended to be associated with having a second event of Multiple sclerosis within a year.
23962560 Data suggest that glypican-5 (GPC5) is a metastasis suppressor gene in non-small cell lung cancer (NSCLC) and may be a potential biomarker that predicts NSCLC metastasis.
23867465 Shh binds to HSPG co-receptors containing a glypican 5 core and 2-O-sulfo-iduronic acid to promote neural precursor proliferation.
23223018 GPC5 is a gene required for normal neural tube development.
22236185 findings suggested that SNP rs2352028 in GPC5 might confer a slight risk to lung cancer/adenocarcinoma
21339334 GPC5 stimulates Hh signaling by facilitating/stabilizing the interaction between Hh and Ptc1.
20966902 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20944657 Observational study of gene-disease association. (HuGE Navigator)
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20692050 This study supports that multiple sclerosis susceptibility at 13q31-32 may localize to the Glypican-5 gene.
20692050 Observational study of gene-disease association. (HuGE Navigator)
20688270 Meta-analysis of gene-disease association. (HuGE Navigator)
20688270 No association between GPC5rs2352028 variant and lung cancer in never smokers in meta-analysis of 7 genome-wide association studies under the random effects model.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360844 GPC5 is a novel genetic locus protective against sudden cardiac arrest
20360844 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20304703 GPC5 polymorphism associated with susceptibility to lung cancer in never smokers
20304703 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19865102 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19590514 Observational study of gene-disease association. (HuGE Navigator)
19556317 Confirm the association of polymorphisms within GPC5 with response to interferon-beta therapy in patients with multiple sclerosis.
19556317 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
19174780 Observational study of gene-disease association. (HuGE Navigator)
19022413 ZIC2, SPRY2, and GPC5 genes are candidate genes suspected to explain the malformations associated with cerebral anomalies in the hypothesis of a contiguous gene syndrome in 13q deletion syndrome
19010793 Independent replication confirms GPC5 as a genetic risk factor for multiple sclerosis.
19010793 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18195134 Genome-wide association study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17846126 Observational study of gene-disease association. (HuGE Navigator)
12721791 GPC5 is a possible target for the 13q31-q32 amplification detected in lymphoma cell lines.

AA Sequence

MDAQTWPVGFRCLLLLALVGSARSEGVQTCEEVRKLFQWRLLGAVRGLPDSPRAGPDLQVCISKKPTCCT      1 - 70
RKMEERYQIAARQDMQQFLQTSSSTLKFLISRNAAAFQETLETLIKQAENYTSILFCSTYRNMALEAAAS     71 - 140
VQEFFTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLINPGVTDSSLEYSECIRMARRDVSPFGNIPQR    141 - 210
VMGQMGRSLLPSRTFLQALNLGIEVINTTDYLHFSKECSRALLKMQYCPHCQGLALTKPCMGYCLNVMRG    211 - 280
CLAHMAELNPHWHAYIRSLEELSDAMHGTYDIGHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPVR    281 - 350
TPTQSPRCSFDQSKEKHGMKTTTRNSEETLANRRKEFINSLRLYRSFYGGLADQLCANELAAADGLPCWN    351 - 420
GEDIVKSYTQRVVGNGIKAQSGNPEVKVKGIDPVINQIIDKLKHVVQLLQGRSPKPDKWELLQLGSGGGM    421 - 490
VEQVSGDCDDEDGCGGSGSGEVKRTLKITDWMPDDMNFSDVKQIHQTDTGSTLDTTGAGCAVATESMTFT    491 - 560
LISVVMLLPGIW                                                              561 - 572
//

Text Mined References (50)

PMID Year Title
25999661 2015 Polymorphisms in C-reactive protein and Glypican-5 are associated with lung cancer risk and Gartrokine-1 influences Cisplatin-based chemotherapy response in a Chinese Han population.
25818666 2015 miR-709 up-regulated in hepatocellular carcinoma, promotes proliferation and invasion by targeting GPC5.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
24943672 2014 Prediction of response to interferon therapy in multiple sclerosis.
24682381 2014 GPC5, a tumor suppressor, is regulated by miR-620 in lung adenocarcinoma.
24456789 2014 Variants in the 5'-upstream region of GPC5 confer risk of lung cancer in never smokers.
24135429 2013 Putative association of GPC5 polymorphism with the risk of inflammatory demyelinating diseases.
24130709 2013 Multiple sclerosis susceptibility genes: associations with relapse severity and recovery.
23962560 2013 Glypican-5 is a novel metastasis suppressor gene in non-small cell lung cancer.
23867465 2013 Heparan sulfate proteoglycans containing a glypican 5 core and 2-O-sulfo-iduronic acid function as Sonic Hedgehog co-receptors to promote proliferation.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23297363 2013 Genome-wide association study identifies loci on 12q24 and 13q32 associated with tetralogy of Fallot.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23223018 2013 Copy number variation analysis implicates the cell polarity gene glypican 5 as a human spina bifida candidate gene.
22236185 2012 GPC5 rs2352028 polymorphism and risk of lung cancer in Han Chinese.
21441931 2011 Common variation in GPC5 is associated with acquired nephrotic syndrome.
21339334 2011 Glypican-5 stimulates rhabdomyosarcoma cell proliferation by activating Hedgehog signaling.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20944657 2011 Replication of top markers of a genome-wide association study in multiple sclerosis in Spain.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20692050 2010 Association to the Glypican-5 gene in multiple sclerosis.
20688270 2010 GPC5 rs2352028 variant and risk of lung cancer in never smokers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360844 2010 Genome-wide association study identifies GPC5 as a novel genetic locus protective against sudden cardiac arrest.
20304703 2010 Genetic variants and risk of lung cancer in never smokers: a genome-wide association study.
20205591 2010 Host determinants of HIV-1 control in African Americans.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
19865102 2010 Multiple sclerosis susceptibility alleles in African Americans.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19590514 2009 FGFR2 is associated with hair thickness in Asian populations.
19556317 2009 Glypican 5 is an interferon-beta response gene: a replication study.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19174780 2009 Confirmation of multiple Crohn's disease susceptibility loci in a large Dutch-Belgian cohort.
19043545 2008 Genetics meets metabolomics: a genome-wide association study of metabolite profiles in human serum.
19022413 Twelve new patients with 13q deletion syndrome: genotype-phenotype analyses in progress.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
18195134 2008 Genome-wide pharmacogenomic analysis of the response to interferon beta therapy in multiple sclerosis.
17846126 2007 Identification of novel candidate genes for type 2 diabetes from a genome-wide association scan in the Old Order Amish: evidence for replication from diabetes-related quantitative traits and from independent populations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12721791 2003 GPC5 is a possible target for the 13q31-q32 amplification detected in lymphoma cell lines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11566272 2001 A 4-Mb BAC/PAC contig and complete genomic structure of the GPC5/GPC6 gene cluster on chromosome 13q32.
11292377 2001 Developmental roles of the glypicans.
9331333 1997 Expression of the cell surface proteoglycan glypican-5 is developmentally regulated in kidney, limb, and brain.
9070915 1997 Characterization of glypican-5 and chromosomal localization of human GPC5, a new member of the glypican gene family.
7657705 1995 K-glypican: a novel GPI-anchored heparan sulfate proteoglycan that is highly expressed in developing brain and kidney.