Property Summary

NCBI Gene PubMed Count 22
PubMed Score 40.36
PubTator Score 26.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 6.600 1.5e-09
psoriasis -2.300 9.9e-05
osteosarcoma 2.796 2.3e-05
posterior fossa group B ependymoma 2.500 6.8e-15
atypical teratoid / rhabdoid tumor 2.700 6.6e-07
glioblastoma 1.100 2.0e-03
primitive neuroectodermal tumor 1.600 4.9e-02
Hydrolethalus syndrome -1.298 2.9e-02
lung cancer -3.000 6.4e-05
diabetes mellitus -1.300 6.7e-03
pediatric high grade glioma 1.300 4.8e-05
group 4 medulloblastoma -1.400 6.5e-05
pilocytic astrocytoma 1.100 2.8e-03
lung adenocarcinoma 1.690 9.4e-06
lung carcinoma -1.900 1.7e-29
Breast cancer 1.300 1.1e-04
ductal carcinoma in situ 1.300 3.6e-02
ovarian cancer -1.900 1.6e-06

 CSPA Cell Line (3)

Gene RIF (4)

PMID Text
23633195 Data suggest gender difference in circulating GPC4 levels in nonalcoholic fatty liver disease; GPC4 levels in women appear to correlate with cardiometabolic risk factors (adiposity/body fat distribution, insulin resistance, and arterial stiffness).
22761013 Findings establish that Gpc4 acts at the interface of extrinsic and intrinsic signal regulation to fine tune stem cell fate.
22644326 new function of miR-125a by targeting gene glypican-4 in cell growth process
19884766 Glypican 4 (GPC4) is downregulated in HIV-1 Tat and NC cotransfection of HEK 293T cells

AA Sequence

MARFGLPALLCTLAVLSAALLAAELKSKSCSEVRRLYVSKGFNKNDAPLHEINGDHLKICPQGSTCCSQE      1 - 70
MEEKYSLQSKDDFKSVVSEQCNHLQAVFASRYKKFDEFFKELLENAEKSLNDMFVKTYGHLYMQNSELFK     71 - 140
DLFVELKRYYVVGNVNLEEMLNDFWARLLERMFRLVNSQYHFTDEYLECVSKYTEQLKPFGDVPRKLKLQ    141 - 210
VTRAFVAARTFAQGLAVAGDVVSKVSVVNPTAQCTHALLKMIYCSHCRGLVTVKPCYNYCSNIMRGCLAN    211 - 280
QGDLDFEWNNFIDAMLMVAERLEGPFNIESVMDPIDVKISDAIMNMQDNSVQVSQKVFQGCGPPKPLPAG    281 - 350
RISRSISESAFSARFRPHHPEERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNGNE    351 - 420
DDCWNGKGKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMALRVMTSKMKNAYNGNDVDFFDIS    421 - 490
DESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQREWR        491 - 556
//

Text Mined References (22)

PMID Year Title
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23633195 2013 Association of glypican-4 with body fat distribution, insulin resistance, and nonalcoholic fatty liver disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22761013 2012 Modulating Glypican4 suppresses tumorigenicity of embryonic stem cells while preserving self-renewal and pluripotency.
22644326 2012 MicroRNA-125a inhibits cell growth by targeting glypican-4.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12009023 2002 Use of a phage display technique to identify potential osteoblast binding sites within osteoclast lacunae.
11336704 2001 Cell surface glypicans are low-affinity endostatin receptors.
11066092 2000 Glypican-4 is an FGF2-binding heparan sulfate proteoglycan expressed in neural precursor cells.
10814714 2000 Mutational analysis of the GPC3/GPC4 glypican gene cluster on Xq26 in patients with Simpson-Golabi-Behmel syndrome: identification of loss-of-function mutations in the GPC3 gene.
10585884 1999 Expression of glypican-4 in haematopoietic-progenitor and bone-marrow-stromal cells.
9931407 1998 Glypican 3 and glypican 4 are juxtaposed in Xq26.1.
9787072 1998 GPC4, the gene for human K-glypican, flanks GPC3 on xq26: deletion of the GPC3-GPC4 gene cluster in one family with Simpson-Golabi-Behmel syndrome.
7925270 1994 Extensive contribution of Rb-deficient cells to adult chimeric mice with limited histopathological consequences.
7657705 1995 K-glypican: a novel GPI-anchored heparan sulfate proteoglycan that is highly expressed in developing brain and kidney.